name | updated | stars | badges |
---|---|---|---|
prowler Prowler is an Open Source Security tool for AWS, Azure, GCP and Kubernetes to do security assessments, audits, incident response, compliance, continuous monitoring, hardening and forensics readiness. | 16 hours ago | 9514 | awsazurecis-benchmark |
finn Dataflow compiler for QNN inference on FPGAs | 16 hours ago | 660 | compilerdataflowfpga |
canarytokens Canarytokens helps track activity and actions on your network. | 16 hours ago | 1648 | |
maltrail Malicious traffic detection system | 16 hours ago | 5734 | attack-detectionintrusion-detectionmalware |
playwright-python Python version of the Playwright testing and automation library. | 16 hours ago | 10631 | chromiumfirefoxplaywright |
mne-python MNE: Magnetoencephalography (MEG) and Electroencephalography (EEG) in Python | 16 hours ago | 2545 | ecogeegelectrocorticography |
posthog 🦔 PostHog provides open-source product analytics, session recording, feature flagging and A/B testing that you can self-host. | 16 hours ago | 16992 | ab-testinganalyticsexperiments |
ehrapy Electronic Health Record Analysis with Python. | 16 hours ago | 112 | ehrelectronic-health-recordelectronic-medical-record |
bunkerweb 🛡️ Make your web services secure by default ! | 16 hours ago | 3420 | antibotbunkerized-nginxcybersecurity |
thug Python low-interaction honeyclient | 16 hours ago | 953 | client-honeypothoneyclientlow-interaction |
core :house_with_garden: Open source home automation that puts local control and privacy first. | 16 hours ago | 68458 | asynciohacktoberfesthome-automation |
plaso Super timeline all the things | 16 hours ago | 1619 | forensicsparsingtimeline |
MONAI AI Toolkit for Healthcare Imaging | 16 hours ago | 5272 | deep-learninghealthcare-imagingmedical-image-computing |
cloudgoat CloudGoat is Rhino Security Labs' "Vulnerable by Design" AWS deployment tool | 16 hours ago | 2426 | |
temboard PostgreSQL Remote Control | 16 hours ago | 437 | administrationdashboarddatabase |
KiBot KiCad automation utility | 17 hours ago | 503 | 3d-modelsautomationbom |
RAFCON RAFCON (RMC advanced flow control) uses hierarchical state machines, featuring concurrent state execution, to represent robot programs. It ships with a graphical user interface supporting the creation | 17 hours ago | 179 | graphical-programmingroboticsstate-machine |
OpenMDAO OpenMDAO repository. | 17 hours ago | 498 | frameworknasaopen-source |
Meshroom 3D Reconstruction Software | 17 hours ago | 10552 | 3d-reconstructionalicevisioncamera-tracking |
dbt-core dbt enables data analysts and engineers to transform their data using the same practices that software engineers use to build applications. | 17 hours ago | 8855 | analyticsbusiness-intelligencedata-modeling |
collective.z3cform.norobots collective.z3cform.norobots provides a "human" captcha widget based on a list of questions/answers. | 17 hours ago | 5 | |
grr GRR Rapid Response: remote live forensics for incident response | 17 hours ago | 4647 | |
pefile pefile is a Python module to read and work with PE (Portable Executable) files | 17 hours ago | 1783 | |
17 hours ago | 3 | ||
psychopy For running psychology and neuroscience experiments | 17 hours ago | 1601 | experimentexperiment-controlexperimental-design |
sigma Main Sigma Rule Repository | 17 hours ago | 7593 | elasticsearchidslogging |
server The Triton Inference Server provides an optimized cloud and edge inferencing solution. | 17 hours ago | 7289 | clouddatacenterdeep-learning |
evm-semantics K Semantics of the Ethereum Virtual Machine (EVM) | 18 hours ago | 497 | |
napari napari: a fast, interactive, multi-dimensional image viewer for python | 18 hours ago | 2053 | naparinumpypython |
dollphone-foss Cute soft icon pack | 18 hours ago | 61 | f-droid |
goth Golem Test Harness, an integration testing framework for yagna - the (new) Golem Network client. | 18 hours ago | 10 | developer-toolsgolemintegration-testing |
owasp-mastg The Mobile Application Security Testing Guide (MASTG) is a comprehensive manual for mobile app security testing and reverse engineering. It describes the technical processes for verifying the controls | 19 hours ago | 11258 | androidandroid-applicationcompliancy-checklist |
kiss-icp A LiDAR odometry pipeline that just works | 19 hours ago | 1345 | 3d-mappingicplidar-slam |
pytest The pytest framework makes it easy to write small tests, yet scales to support complex functional testing | 19 hours ago | 11340 | hacktoberfestpythontest |
wagtail_editorjs EditorJS Wagtail widget with page, document and image- chooser functionality. | 19 hours ago | 5 | djangopythonpython3 |
mvt MVT (Mobile Verification Toolkit) helps with conducting forensics of mobile devices in order to find signs of a potential compromise. | 19 hours ago | 9777 | androidforensicsforensics-tools |
thinc 🔮 A refreshing functional take on deep learning, compatible with your favorite libraries | 19 hours ago | 2787 | aiartificial-intelligencedeep-learning |
quark-engine Dig Vulnerabilities in the BlackBox | 19 hours ago | 1223 | androidblackboxblackbox-testing |
sqlfluff A modular SQL linter and auto-formatter with support for multiple dialects and templated code. | 20 hours ago | 7192 | hacktoberfestpypisql |
thingsboard-gateway Open-source IoT Gateway - integrates devices connected to legacy and third-party systems with ThingsBoard IoT Platform using Modbus, CAN bus, BACnet, BLE, OPC-UA, MQTT, ODBC and REST protocols | 22 hours ago | 1578 | awsaws-iotbacnet |
collective.elastic.plone Plone Search Integration: Addon to index content in Open-/ElasticSearch | 22 hours ago | 3 | cmselasticsearchopensearch |
golem-stats-backend The backend serving https://stats.golem.network with data. It's available at https://api.stats.golem.network | 23 hours ago | 1 | golem |
canopen CANopen for Python | 23 hours ago | 410 | cancanopenpython |
wee-slack A WeeChat script for Slack.com. Supports threads and reactions, synchronizes read markers, provides typing notification, etc.. | 23 hours ago | 2501 | |
jetson-containers Machine Learning Containers for NVIDIA Jetson and JetPack-L4T | 23 hours ago | 1615 | containersdockerdockerfiles |
commix Automated All-in-One OS Command Injection Exploitation Tool. | yesterday | 4319 | bugbountycommand-injectioncommix |
pyvista 3D plotting and mesh analysis through a streamlined interface for the Visualization Toolkit (VTK) | yesterday | 2343 | 3dhacktoberfestmesh |
ptf The Penetration Testers Framework (PTF) is a way for modular support for up-to-date tools. | yesterday | 4969 | |
mac_apt macOS (& ios) Artifact Parsing Tool | yesterday | 715 | dfirforensicsmacos |
wagtailterms A Wagtail plugin to add support for glossary terms entity to Draftail | yesterday | 1 | |
yesterday | 72 | ||
dipy DIPY is the paragon 3D/4D+ imaging library in Python. Contains generic methods for spatial normalization, signal processing, machine learning, statistical analysis and visualization of medical images. | yesterday | 668 | bundlescontextual-enhancementdenoising |
selene User-oriented Web UI browser tests in Python | yesterday | 666 | automatione2e-testingpython |
sqlglot Python SQL Parser and Transpiler | yesterday | 5423 | bigqueryclickhousedatabricks |
yesterday | 15 | ||
federated A framework for implementing federated learning | yesterday | 2274 | |
algokit-cli The Algorand AlgoKit CLI is the one-stop shop tool for developers building on the Algorand network. | yesterday | 150 | |
public-apis A collective list of free APIs | yesterday | 291595 | apiapisdataset |
python-gitlab A python wrapper for the GitLab API. | yesterday | 2161 | apigitlabgitlab-api |
wagtail-cookiecutter-foundation A Cookiecutter template for Wagtail CMS using Zurb Foundation 6 | yesterday | 166 | |
wagtail-resume A Wagtail project made to simplify creation of resumes for developers. | yesterday | 88 | djangoresumeresume-template |
plotly.py The interactive graphing library for Python :sparkles: This project now includes Plotly Express! | yesterday | 15223 | d3dashboarddeclarative |
mapillary_tools Command line tools for processing and uploading Mapillary imagery | yesterday | 251 | |
RoboticsAcademy Learn Robotics with JdeRobot | yesterday | 296 | computer-visiongazeborobotics |
pghoard PostgreSQL® backup and restore service | yesterday | 1279 | aivenbackupcloud-object-storage |
graspologic Python package for graph statistics | yesterday | 499 | data-sciencegraphgraph-statistics |
caringcaribou A friendly car security exploration tool for the CAN bus | 2 days ago | 670 | can-busecufuzzing |
spack A flexible package manager that supports multiple versions, configurations, platforms, and compilers. | 2 days ago | 3941 | build-toolshpclinux |
OpenPCDet OpenPCDet Toolbox for LiDAR-based 3D Object Detection. | 2 days ago | 4297 | 3d-detectionautonomous-drivingobject-detection |
cog Containers for machine learning | 2 days ago | 7080 | aicontainerscuda |
mx Command-line tool used for the development of Graal projects. | 2 days ago | 179 | |
pwntools CTF framework and exploit development library | 2 days ago | 11447 | assemblybsdcapture-the-flag |
eds-scikit eds-scikit is a Python library providing tools to process and analyse OMOP data | 2 days ago | 31 | clinical-data-warehousedata-sciencemedical |
zsh-completions-bio Missing zsh shell completion scripts for bioinformatics tools | 2 days ago | 6 | |
Arcticons A monotone line-based icon pack for android | 2 days ago | 833 | androidf-droidfdroid |
voila Voilà turns Jupyter notebooks into standalone web applications | 2 days ago | 5197 | dashboardingjupyterjupyter-notebook |
pipx Install and Run Python Applications in Isolated Environments | 2 days ago | 8763 | clipippypi |
dftimewolf A framework for orchestrating forensic collection, processing and data export | 2 days ago | 273 | |
python-can The can package provides controller area network support for Python developers | 2 days ago | 1168 | can-buspython |
influxdb-python Python client for InfluxDB | 2 days ago | 1678 | influxdatainfluxdbpython |
2 days ago | 183 | ||
roslibpy Python ROS Bridge library | 2 days ago | 263 | pythonroboticsros |
pylint It's not just a linter that annoys you! | 2 days ago | 5103 | closembercode-qualityhacktoberfest |
collective.exportimport Export and import content and other data from and to Plone | 2 days ago | 15 | exportinghacktoberfestimporting |
mitmproxy An interactive TLS-capable intercepting HTTP proxy for penetration testers and software developers. | 2 days ago | 34284 | debugginghttphttp2 |
ansible-lint ansible-lint checks playbooks for practices and behavior that could potentially be improved and can fix some of the most common ones for you | 2 days ago | 3324 | ansibleansible-dev-toolsansible-lint |
cookiecutter A cross-platform command-line utility that creates projects from cookiecutters (project templates), e.g. Python package projects, C projects. | 2 days ago | 21539 | cookiecutterpython |
sshuttle Transparent proxy server that works as a poor man's VPN. Forwards over ssh. Doesn't require admin. Works with Linux and MacOS. Supports DNS tunneling. | 2 days ago | 11085 | |
zentral Zentral is a high-visibility platform for controlling Apple endpoints in enterprises. It brings great observability to IT and makes tracking & reporting compliance much less manual. | 2 days ago | 719 | apple-mdmelasticsearchendpoint-management |
volatility3 Volatility 3.0 development | 2 days ago | 2197 | digital-investigationforensicsincident-response |
winbindex An index of Windows binaries, including download links for executables such as exe, dll and sys files | 2 days ago | 531 | |
collective.z3cform.datagridfield Datagrid Field for z3c.forms | 2 days ago | 8 | |
dotenv-linter :relaxed: Linting dotenv files like a charm! | 2 days ago | 270 | code-qualitydotenvdotenv-parser |
PyHealth A Deep Learning Python Toolkit for Healthcare Applications. | 2 days ago | 878 | clinical-dataclinical-researchdata-mining |
odmantic Sync and Async ODM (Object Document Mapper) for MongoDB based on python type hints | 2 days ago | 972 | asyncasynciodatabase |
git-revise A handy tool for doing efficient in-memory commit rebases & fixups | 2 days ago | 711 | |
jiten jiten - japanese android/cli/web dictionary based on jmdict/kanjidic — 日本語 辞典 和英辞典 漢英字典 和独辞典 和蘭辞典 | 2 days ago | 95 | androidaudiocli |
Malcolm Malcolm is a powerful, easily deployable network traffic analysis tool suite for full packet capture artifacts (PCAP files), Zeek logs and Suricata alerts. | 2 days ago | 307 | arkimecybersecurityinfosec |
projecttier.org Wagtail website for Project TIER | 2 days ago | 11 | agpldjangoeducation |
RootTheBox A Game of Hackers (CTF Scoreboard & Game Manager) | 2 days ago | 872 | ctfscoring-enginesecurity |
qtpy Provides an uniform layer to support PyQt5, PySide2, PyQt6, PySide6 with a single codebase | 2 days ago | 926 | closemberpyqtpyqt6 |
InvenTree Description This iOS app integrates natively with the InvenTree open source inventory management and stock control database. With tightly integrated barcode scanning functionality, the app provides | 2 days ago | 3687 | djangohacktoberfestpython |
openpilot openpilot is an open source driver assistance system. openpilot performs the functions of Automated Lane Centering and Adaptive Cruise Control for 250+ supported car makes and models. | 2 days ago | 47352 | |
pvlib-python A set of documented functions for simulating the performance of photovoltaic energy systems. | 2 days ago | 1066 | photovoltaicpythonrenewable-energy |
Fiona Fiona reads and writes geographic data files | 2 days ago | 1123 | clicythongdal |
cti-python-stix2 OASIS TC Open Repository: Python APIs for STIX 2 | 2 days ago | 349 | cticyber-threat-intelligencejson |
playwright-pytest Pytest plugin to write end-to-end browser tests with Playwright. | 2 days ago | 397 | playwrightpytest-plugintesting-tools |
PINCE Reverse engineering tool for linux games | 2 days ago | 1913 | assemblercheat-enginedebugging-tool |
CAPEv2 Malware Configuration And Payload Extraction | 2 days ago | 1645 | capeconfigsdebugging-tools |
django-oscar-accounts Managed accounts for Django (with or without django-oscar) | 2 days ago | 210 | |
glasgow Scots Army Knife for electronics | 2 days ago | 1844 | debugging-toolfpgahardware |
abstra-lib Python-based BPM | 2 days ago | 123 | bpmbpmnbusiness-process-automation |
VolUtility Web App for Volatility framework | 2 days ago | 373 | |
securedrop.org Code for the SecureDrop project website | 2 days ago | 39 | |
androguard Reverse engineering and pentesting for Android applications | 2 days ago | 4926 | androiddalvikdex |
OpenAeroStruct OpenAeroStruct is a lightweight tool that performs aerostructural optimization using OpenMDAO. | 2 days ago | 169 | aerodynamicsopen-sourceopenmdao |
Hierarchical-Localization Visual localization made easy with hloc | 2 days ago | 2814 | deep-learningfeature-matchingimage-retrieval |
consumerfinance.gov Django project protecting American consumers | 3 days ago | 247 | djangohacktoberfestpython |
data-diff Compare tables within or across databases | 3 days ago | 2828 | datadata-diffingdata-engineering |
drozer The Leading Security Assessment Framework for Android. | 3 days ago | 3590 | androiddrozerjava |
antimeridian Fix GeoJSON polygons that cross the antimeridian | 3 days ago | 35 | antimeridiangeojsongeospatial |
kaapana Kaapana (from the hawaiian word kaʻāpana, meaning “distributor” or “part”) is an open source toolkit for state of the art platform provisioning in the field of medical data analysis. The applications | 3 days ago | 143 | aicloud-computingimaging |
SecGen Create randomly insecure VMs | 3 days ago | 2574 | ctf-challengescyboklabs |
pyroSAR framework for large-scale SAR satellite data processing | 3 days ago | 468 | earth-observationgdalpython |
barman Barman - Backup and Recovery Manager for PostgreSQL | 3 days ago | 1837 | backupdisaster-recoverypostgres |
compas_fab Robotic fabrication package for the COMPAS Framework. | 3 days ago | 103 | aecarchitecturecompas |
biolink-model Schema and generated objects for biolink data model and upper ontology | 3 days ago | 162 | biolinkdatamodelgene-ontology |
helium Lighter web automation for Python | 3 days ago | 4103 | chromefirefoxhelium |
rero-ils Integrated Library System flavour of Invenio by RERO+. | 3 days ago | 64 | ilsinveniolibrary-management-system |
relate RELATE is an Environment for Learning And TEaching | 3 days ago | 362 | code-homeworkcode-questioncourse-management |
pybotics The Python Toolbox for Robotics | 3 days ago | 316 | calibrationdoidynamics |
WireViz Easily document cables and wiring harnesses. | 3 days ago | 3907 | cablesconnectorshardware |
jupyterhub Multi-user server for Jupyter notebooks | 3 days ago | 7567 | ipythonjupyter-notebookjupyterhub |
readthedocs.org The source code that powers readthedocs.org | 3 days ago | 7868 | docsmkdocspython |
PythonRobotics Python sample codes for robotics algorithms. | 3 days ago | 21629 | algorithmanimationautonomous-driving |
intelmq IntelMQ is a solution for IT security teams for collecting and processing security feeds using a message queuing protocol. | 3 days ago | 930 | alertsautomationcert |
dem Containerized Development Environment Manager for embedded development | 3 days ago | 61 | containerizationcontainersdeveloper-tools |
ansible-role-mongodb Ansible role to configure MongoDB | 3 days ago | 340 | |
collective.taxonomy Create, edit and use hierarchical taxonomies in Plone! | 3 days ago | 18 | hacktoberfestploneplone-addon |
flare-floss FLARE Obfuscated String Solver - Automatically extract obfuscated strings from malware. | 3 days ago | 3008 | deobfuscationflaregsoc-2024 |
docker-packing-box Docker image gathering packers and tools for making datasets of packed executables and training machine learning models for packing detection | 3 days ago | 42 | binary-analysisdataset-generationdocker-image |
OCRmyPDF OCRmyPDF adds an OCR text layer to scanned PDF files, allowing them to be searched | 3 days ago | 11917 | image-processingocrpdf |
ScoutSuite Multi-Cloud Security Auditing Tool | 3 days ago | 6139 | auditingawsazure |
cassandra-medusa Apache Cassandra Backup and Restore Tool | 3 days ago | 252 | |
BlenderProc A procedural Blender pipeline for photorealistic training image generation | 3 days ago | 2535 | 3d-engines3d-front-dataset3d-graphics |
capa The FLARE team's open-source tool to identify capabilities in executable files. | 3 days ago | 3838 | gsoc-2024malware-analysisreverse-engineering |
Kiwi open source test management system with over 2 million downloads! | 3 days ago | 930 | managementqaqa-team |
python-taiga :evergreen_tree: Python module for communicating with the Taiga API | 3 days ago | 92 | hacktoberfestpythonrest |
flirpy Python library to interact with FLIR camera cores | 3 days ago | 176 | camerasflir-camera-coresflir-cameras |
bracket Selfhosted tournament system with web interface | 3 days ago | 113 | apibracketbrackets |
pretalx Conference planning tool: CfP, scheduling, speaker management | 3 days ago | 657 | call-for-papercall-for-paperscfp |
githubsecrets Manage your GitHub Actions secrets with a simple CLI | 3 days ago | 42 | clidockergithub |
sickchill Less rage, more chill. | 3 days ago | 2376 | dognzbepisodeskodi |
bandit Bandit is a tool designed to find common security issues in Python code. | 3 days ago | 5966 | banditlinterpython |
sqllineage SQL Lineage Analysis Tool powered by Python | 3 days ago | 1117 | data-discoverydata-governancedata-lineage |
django-modeltranslation Translates Django models using a registration approach. | 3 days ago | 1324 | djangopythontranslation |
westernfriend.org A website for Western Friend (westernfriend.org), a Quaker publication that provides resources and support for Quaker communities and individuals seeking to live out their faith in the world. Western | 3 days ago | 51 | communitydjangoecommerce |
wagtail-modeltranslation Simple app to patch modeltranslation (https://github.com/deschler/django-modeltranslation) into Wagtail CMS. | 3 days ago | 148 | |
biopython Official git repository for Biopython (originally converted from CVS) | 3 days ago | 4153 | bioinformaticsbiopythondna |
wagtail-wordpress-import A package for Wagtail CMS to import WordPress blog content from an XML file into Wagtail | 3 days ago | 38 | importwagtailwordpress |
wagtailmedia A Wagtail module for managing video and audio files within the admin | 3 days ago | 219 | audiodjangohacktoberfest |
wagtail-markdown Markdown support for Wagtail | 3 days ago | 180 | djangohacktoberfestmarkdown |
wagtail-headless-preview Previews for headless Wagtail setups | 3 days ago | 114 | headlesswagtailwagtail-cms |
yq Command-line YAML, XML, TOML processor - jq wrapper for YAML/XML/TOML documents | 3 days ago | 2451 | clicommand-linejq |
django-recaptcha Django reCAPTCHA form field/widget integration app. | 3 days ago | 961 | djangopythonrecaptcha |
android Delta Icons for Android | 3 days ago | 513 | 2023androidcustomization |
Shifter A simple, self-hosted file-sharing web app, powered by Django | 3 days ago | 18 | djangodockerfile-sharing |
algoworld-contracts 🤖 A collection of Algorand Smart Signatures and Contracts for swaps and trading 🎴 | 3 days ago | 30 | algorandalgoworldawesome-algorand |
fava Fava - web interface for Beancount | 3 days ago | 1809 | beancountledgerplaintext-accounting |
cowrie Cowrie SSH/Telnet Honeypot https://cowrie.readthedocs.io | 3 days ago | 4904 | attackercowriecowrie-ssh |
kinto A generic JSON document store with sharing and synchronisation capabilities. | 3 days ago | 4297 | apidecentralisationhttp |
porcupine On-device wake word detection powered by deep learning | 3 days ago | 3416 | handsfreehotwordhotword-detection |
PayloadsAllTheThings A list of useful payloads and bypass for Web Application Security and Pentest/CTF | 3 days ago | 56630 | bountybugbountybypass |
rdflib RDFLib is a Python library for working with RDF, a simple yet powerful language for representing information. | 3 days ago | 2078 | graphjson-ldlinked-data |
RsaCtfTool RSA attack tool (mainly for ctf) - retrieve private key from weak public key and/or uncipher data | 3 days ago | 5230 | cryptographyrsarsa-attack |
wagtail-localize Translation plugin for Wagtail CMS | 3 days ago | 209 | internationalisationwagtailwagtail-package |
tappy Python Test Anything Protocol (TAP) tools | 3 days ago | 133 | pythontap |
autosar A set of python modules for working with AUTOSAR XML files | 4 days ago | 333 | arxmlautosarautosar-classic |
jira Python Jira library. Development chat available on https://matrix.to/#/#pycontribs:matrix.org | 4 days ago | 1883 | jirapythonpython3-only |
pygments Pygments is a generic syntax highlighter written in Python | 4 days ago | 1702 | pythonsyntax-highlighting |
acquire acquire is a tool to quickly gather forensic artifacts from disk images or a live system into a lightweight container. | 4 days ago | 74 | |
jupyter-book Create beautiful, publication-quality books and documents from computational content. | 4 days ago | 3680 | documentation-generatorjupytersphinx-doc |
gef GEF (GDB Enhanced Features) - a modern experience for GDB with advanced debugging capabilities for exploit devs & reverse engineers on Linux | 4 days ago | 6468 | binary-ninjactfdebugging |
armory 3D Engine with Blender Integration | 4 days ago | 2989 | 3dblendergame-engine |
satpy Python package for earth-observing satellite data processing | 4 days ago | 1005 | closemberdaskhacktoberfest |
spot_ros ROS driver for controlling Boston Dynamics' Spot robot | 4 days ago | 259 | ros |
labelme Image Polygonal Annotation with Python (polygon, rectangle, circle, line, point and image-level flag annotation). | 4 days ago | 12286 | annotationsclassificationcomputer-vision |
babybuddy A :baby: buddy to help caregivers track sleep, feedings, diaper changes, and tummy time to learn about and predict baby's needs without (as much) guess work. | 4 days ago | 1915 | babydashboarddjango |
RecoverPy Interactively find and recover deleted or :point_right: overwritten :point_left: files from your terminal | 4 days ago | 1166 | cliconsolecybersecurity |
spilo Highly available elephant herd: HA PostgreSQL cluster using Docker | 4 days ago | 1303 | data-infrastructuredockerdocker-image |
yt-dlp A feature-rich command-line audio/video downloader | 4 days ago | 69974 | pythonsponskrubsponsorblock |
flowblade Video Editor for Linux | 4 days ago | 2539 | |
censys-python An easy-to-use and lightweight API wrapper for Censys APIs. | 4 days ago | 372 | apiattack-surface-managementcensys |
phobos An add-on for Blender allowing to create URDF, SDF and SMURF robot models in a WYSIWYG environment. | 4 days ago | 634 | blendergazebomars |
boofuzz A fork and successor of the Sulley Fuzzing Framework | 4 days ago | 1954 | fuzzingpythonsecurity |
open-simulation-interface A generic interface for the environmental perception of automated driving functions in virtual scenarios. | 4 days ago | 259 | asamopen-simulation-interfaceosi |
neomodel An Object Graph Mapper (OGM) for the Neo4j graph database. | 4 days ago | 886 | neo4jogmpython |
4 days ago | 77 | ||
FIR Fast Incident Response | 4 days ago | 1664 | |
click-completion Add or enhance bash, fish, zsh and powershell completion in Click | 4 days ago | 284 | |
BayesianOptimization A Python implementation of global optimization with gaussian processes. | last year | 6726 | bayesian-optimizationgaussian-processesoptimization |
pysnmp Python SNMP library | last year | 560 | mibpysnmppython |
awesome-decision-tree-papers A collection of research papers on decision, classification and regression trees with implementations. | last year | 2255 | cartcatboostclassification-model |
sen Terminal User Interface for containers. | last year | 948 | containersdockerdocker-tui |
mp_lvgl_widgets Widgets for the MicroPython Port of LVGL | last year | 2 | |
milksnake A setuptools/wheel/cffi extension to embed a binary data in wheels | last year | 787 | tag-production |
Dwarf Full featured multi arch/os debugger built on top of PyQt5 and frida | last year | 1224 | androidcapstone-enginecracking |
dlint Dlint is a tool for encouraging best coding practices and helping ensure Python code is secure. | last year | 162 | dlintflake8linter |
github-issues-import Python script to import issues from one repository into another, either one at a time or all of them at once. | last year | 421 | |
unicode-slugify A slugifier that works in unicode | last year | 319 | |
aminator A tool for creating EBS AMIs. This tool currently works for CentOS/RedHat Linux images and is intended to run on an EC2 instance. | last year | 939 | |
MXFusion Modular Probabilistic Programming on MXNet | last year | 102 | bayesian-inferencemachine-learningmxnet |
Complete_Street_Rule The Complete Street Rule for ArcGIS CityEngine is a scenario oriented design tool intended to enable users to quickly create procedurally generated multimodal streets. | last year | 157 | arcgis-cityenginecgacityengine |
mpy-wpa_supplicant MicroPython wpa-supplicant | last year | 0 | |
soundcloud-python A Python wrapper around the Soundcloud API | last year | 95 | |
igel a delightful machine learning tool that allows you to train, test, and use models without writing code | last year | 3071 | artificial-intelligenceautomationautoml |
python-iocextract Defanged Indicator of Compromise (IOC) Extractor. | last year | 415 | base64decodingdefang |
money Python money class with optional CLDR-backed locale-aware formatting and an extensible currency exchange solution. | last year | 224 | |
CanCat swiss army knife of Controller Area Networks (CAN) often used in cars and building automation, etc... | last year | 191 | |
prospector Inspects Python source files and provides information about type and location of classes, methods etc | last year | 1793 | |
HaboMalHunter HaboMalHunter is a sub-project of Habo Malware Analysis System (https://habo.qq.com), which can be used for automated malware analysis and security assessment on the Linux system. | last year | 722 | dynamic-analysiselflinux |
last year | 8 | ||
auction-demo An example smart contract NFT auction on Algorand | last year | 58 | algorandauctionblockchain |
last year | 29 | ||
MP2300-Tools My collection of tools I've written for the graphtec MP2300 plotter. Demo: | last year | 6 | open-sourceotterplotter |
piccolo_examples Example projects built using Piccolo. | last year | 19 | |
cl4py Common Lisp for Python | last year | 82 | common-lisppython |
ros2-tensorflow ROS2 nodes for computer vision tasks in Tensorflow | last year | 51 | computer-visionimage-classificationimage-detection |
salmon A Python Mail Server | last year | 617 | emaillmtplmtp-server |
tacofancy-api Making an API for https://github.com/sinker/tacofancy | last year | 118 | |
puresnmp Pure Python SNMPv2 Library | last year | 75 | pythonpython-3snmp |
HASS-data-detective Explore and analyse your Home Assistant data | last year | 175 | datadata-sciencehome |
pandas_flavor The easy way to write your own flavor of Pandas | last year | 274 | pandas |
smof Explore and analyze biological sequence data | last year | 14 | bioinformaticsbiologyfasta |
hot-redis Rich Python data types for Redis | last year | 289 | |
cecilia5 Ear-bending noises and music | last year | 205 | |
roboschool DEPRECATED: Open-source software for robot simulation, integrated with OpenAI Gym. | last year | 2082 | |
baselines OpenAI Baselines: high-quality implementations of reinforcement learning algorithms | last year | 14407 | |
flask-reactize flask-reactize is a boostrap to serve any React JS application via a Python back-end, using Flask as web framework. | last year | 7 | |
fastapi-celery Minimal example utilizing fastapi and celery with RabbitMQ for task queue, Redis for celery backend and flower for monitoring the celery tasks. | last year | 448 | celerydocker-composefastapi |
streamingbandit Python application to setup and run streaming (contextual) bandit experiments. | last year | 79 | banditcmabcontextual |
gimel Run your own A/B testing backend using AWS Lambda and Redis HyperLogLog | last year | 227 | |
cstar_perf Apache Cassandra performance testing platform | last year | 72 | |
blender-artnet Blender script to push artnet data to Evee lights | last year | 36 | |
pangu.py Paranoid text spacing in Python | last year | 218 | pangupythontext |
fuck-coding-interviews How on earth can I ever think of a solution like that in an interview?! | last year | 663 | algorithmscoding-interviewsdata-structures |
quant-trading Python quantitative trading strategies including VIX Calculator, Pattern Recognition, Commodity Trading Advisor, Monte Carlo, Options Straddle, Shooting Star, London Breakout, Heikin-Ashi, Pair Tradin | last year | 4804 | algorithmic-tradingbollinger-bandscommodity-trading |
rpg_trajectory_evaluation Toolbox for quantitative trajectory evaluation of VO/VIO | last year | 986 | |
collective.cover A sane, working, editor-friendly way of creating front pages and other composite pages. Working now, for mere mortals. | last year | 48 | |
verible-linter-action Automatic SystemVerilog linting in github actions with the help of Verible | last year | 21 | |
pico-wave-vibration-generator A MicroPython-based frequency generator for Raspberry Pi Pico designed to create vibrations on solenoids or speakers, enabling wave experimentation and exploration at home. | last year | 2 | |
make_gtfs A Python 3.8+ library to build GTFS feeds from basic route information. | last year | 2 | |
ranger-zshz A plugin to integrate zsh-z into ranger. | last year | 4 | |
minipb Lightweight Protocol Buffer serialize/deserialize library | last year | 50 | micropythonprotobuf |
playstation-box Update a pinned gist to contain your PlayStation stats | last year | 13 | awesome-pinned-gistspinned-gistprofile-readme |
eosfactory Python-based EOS smart-contract development & testing framework | last year | 243 | eospythonsmart-contracts |
last year | 168 | ||
matchering 🎚️ Open Source Audio Matching and Mastering | last year | 948 | audiodocker-imagedsp |
mmWave-localization-learning 🎯 ML-based positioning method from mmWave transmissions - with high accuracy and energy efficiency | last year | 106 | 5gbeamformingcnn |
pg_view Get a detailed, real-time view of your PostgreSQL database and system metrics | last year | 489 | monitoring |
bluebert BlueBERT, pre-trained on PubMed abstracts and clinical notes (MIMIC-III). | last year | 537 | bertbert-modellanguage-model |
HyperPose Library for Fast and Flexible Human Pose Estimation | last year | 1238 | computer-visiondistributed-trainingmobilenet |
pyodds An End-to-end Outlier Detection System | last year | 245 | anomaly-detectiondatabasedeep-learning |
rex-gym OpenAI Gym environments for an open-source quadruped robot (SpotMicro) | last year | 962 | artificial-intelligencegym-environmentinverse-kinematics |
trading-rl Deep Reinforcement Learning for Financial Trading using Price Trailing @ ICASSP 2019 | last year | 214 | |
OverlapNet OverlapNet - Loop Closing for 3D LiDAR-based SLAM (chen2020rss) | last year | 628 | 3d-lidarlidarloop-closing |
pylot Modular autonomous driving platform running on the CARLA simulator and real-world vehicles. | last year | 426 | autonomous-drivingautonomous-vehiclescarla |
NeuroNER Named-entity recognition using neural networks. Easy-to-use and state-of-the-art results. | last year | 1672 | deep-learningmachine-learningnamed-entity-recognition |
leafmap A Python package for interactive mapping and geospatial analysis with minimal coding in a Jupyter environment | last year | 1555 | data-sciencedatavizfolium |
mrjob Run MapReduce jobs on Hadoop or Amazon Web Services | last year | 2609 | |
seqlearn Sequence learning toolkit for Python | last year | 667 | |
wagtail-meta-preview Wagtail Meta Preview provides panels for previewing Facebook sharing, Twitter sharing and Google search results in the Wagtail admin. | last year | 25 | metapreviewshare |
Zappa Serverless Python | last year | 11906 | api-gatewayaws-lambdabottle |
typilus-action A GitHub Action for suggesting Python type annotations. | last year | 40 | github-actionsmachine-learningpython3 |
pylint It's not just a linter that annoys you! | last year | 4585 | closembercode-qualityhacktoberfest |
highway-env A minimalist environment for decision-making in autonomous driving | last year | 1712 | autonomous-drivinggym-environmentreinforcement-learning |
Pokemon-Terminal Pokemon terminal themes. | last year | 4153 | bashiterm2linux |
pyramid_storage File upload management for the Pyramid web framework | last year | 13 | |
bda.plone.gtm Google Tag Manager Intergation | last year | 2 | |
unbd Micro implementation of network block device (NBD) for micropython | last year | 2 | |
skater Python Library for Model Interpretation/Explanations | last year | 1065 | attributionblackboxcnn-classification |
captcha_recognize Image Recognition captcha without image segmentation 无需图片分割的验证码识别 | last year | 547 | captchacaptcha-breakingimage-recognition-captchas |
piclock_advanced Clock / Infoscreen for radiostudios | last year | 2 | broadcastinfoscreenradio |
reverse-geocoder A fast, offline reverse geocoder in Python | last year | 1861 | |
cl-project-with-docs Common Lisp project skeleton generator which uses Sphinx and reStructured text to render nice and readable HTML documentation. | last year | 3 | |
meerkat Data acquisition for Raspberry Pi and Micropython | last year | 7 | data-sciencedriversmicropython |
max7219_8digit Micropython driver for the max7219 with 8 x 7segment display | last year | 22 | |
lightning-bolts Toolbox of models, callbacks, and datasets for AI/ML researchers. | last year | 1509 | aiganimage-processing |
awesome-graph-classification A collection of important graph embedding, classification and representation learning papers with implementations. | last year | 4679 | attention-mechanismclassification-algorithmdeep-graph-kernels |
collective.pwexpiry Emulate Active Directory password complexity requirements. | last year | 1 | |
scoop SCOOP (Scalable COncurrent Operations in Python) | last year | 595 | |
threatbus 🚌 Threat Bus – A threat intelligence dissemination layer for open-source security tools. | last year | 255 | cifcif3ids |
infer-types A CLI tool to automatically add type annotations into Python code. Must have tool for annotating existing code. | last year | 66 | annotationscode-formattercode-generation |
code2flow Pretty good call graphs for dynamic languages | last year | 3166 | |
gnss-ins-sim Open-source GNSS + inertial navigation, sensor fusion simulator. Motion trajectory generator, sensor models, and navigation | last year | 1077 | gnssgpsimu |
CapTipper Malicious HTTP traffic explorer | last year | 697 | |
upy-websocket-server Micropython (ESP8266) websocket server implementation. | last year | 73 | |
MINER MINER provided by the paper "MINER: A Hybrid Data-Driven Approach for REST API Fuzzing" | last year | 26 | |
coacervate Coacervate is a free and open-source public good that lets you easily run genomic analyses on an extremely low-cost global supercomputer, democratizing access to the knowledge and infrastructure requi | last year | 4 | bioinformaticsgenomicsgolem |
morefusion MoreFusion: Multi-object Reasoning for 6D Pose Estimation from Volumetric Fusion, CVPR 2020 | last year | 223 | artificial-intelligencecomputer-visiondeep-learning |
jrnl Collect your thoughts and notes without leaving the command line. | last year | 38 | |
slackbot A chat bot for Slack (https://slack.com). | last year | 1254 | |
bcbb Incubator for useful bioinformatics code, primarily in Python and R | last year | 582 | |
scratchrelaxtv :tv: Terraform module development tool. | last year | 27 | |
django-remote-forms A platform independent django form serializer | last year | 224 | |
inkscape-raytracing An extension for Inkscape that makes it easier to draw optical diagrams. | last year | 301 | inkscape-extensionopticsoptics-simulation |
updog Updog is a replacement for Python's SimpleHTTPServer. It allows uploading and downloading via HTTP/S, can set ad hoc SSL certificates and use http basic auth. | last year | 2520 | file-sharingfile-uploadhttp-server |
promformat PromQL formatter | last year | 31 | formatterpromql |
MicroPyDatabase A low-memory json-based database for MicroPython | last year | 16 | |
mqtt_bridge mqtt_bridge provides a functionality to bridge between ROS and MQTT in bidirectional | last year | 151 | |
vim-ros Vim plugin for ROS development | last year | 131 | rosvimvim-plugin |
micropython-hcsr04 Micropython driver for ultrasonic sensor HC-SR04 | last year | 129 | |
cohesion A tool for measuring Python class cohesion. | last year | 220 | classcodecohesion |
Products.PrintingMailHost A monkey patch to send MailHost messages to standard out | last year | 2 | |
datamol Molecular Manipulation Made Easy. | last year | 288 | cheminformaticsdrug-designdrug-discovery |
ziggurat_foundations Framework agnostic set of sqlalchemy classes that make building applications that require permissions an easy task. | last year | 70 | authenticationauthorizationflask |
SwagLyrics-For-Spotify 📃 Get lyrics of currently playing Spotify song so you don't sing along with the wrong ones and embarrass yourself later. Very fast. | last year | 314 | applicationflaskgenius |
last year | 2849 | ||
DS3231micro Micropython library for DS3231 | last year | 15 | |
jupyterlab-quickopen Quickly open a file in JupyterLab by typing part of its name | last year | 75 | jupyterjupyterlabjupyterlab-extension |
cuisine Chef-like functionality for Fabric | last year | 1259 | |
gentle gentle forced aligner | last year | 1337 | |
panic_polkadot 🚨 PANIC for Polkadot | last year | 40 | alerterblockchainmonitoring |
panic_polkadot 🚨 PANIC for Polkadot | last year | 38 | alerterblockchainmonitoring |
micropython-zacwire MicroPython implementation of the ZACwire protocol used in TSic 506F temperature sensors. | last year | 0 | |
ros_jetson_stats 🐢 The ROS jetson-stats wrapper. The status of your NVIDIA jetson in diagnostic messages | last year | 66 | diagnosticsjetson-nanojetson-stats |
masonite-inertia Server-side Masonite adapter for Inertia.js | last year | 23 | inertiajsmasonitemasonite-package |
wagtail-image-import Adds bulk image import from Google Drive to the Wagtail Admin | last year | 11 | |
jupyter-ros2 Jupyter widget helpers for ros2, the Next-Generation of the Robot Operating System | last year | 24 | |
makesite Simple, lightweight, and magic-free static site/blog generator for Python coders | last year | 1742 | |
photonix A modern, web-based photo management server. Run it on your home server and it will let you find the right photo from your collection on any device. Smart filtering is made possible by object recognit | last year | 1647 | aidjangodocker |
spafe :sound: spafe: Simplified Python Audio Features Extraction | last year | 415 | audioaudio-analysisbeat |
HerePy A library that provides a Python interface to the HERE location APIs. | last year | 84 | api-wrapperev-chargingfleet-telematics |
AS5600 AS560 Micropython library for reading this magnetic sensor | last year | 21 | |
dota2 🐸 Python package for interacting with Dota 2 Game Coordinator | last year | 191 | dota2game-coordinatorhacktoberfest |
YeomanPywork 🐍Pywork is a Yeoman generator to scaffold a Bare-bone Python Application | last year | 11 | fastapigeneratorlogzero |
django-slack Slack integration for Django, using the templating engine to generate messages | last year | 238 | |
SRGAN Photo-Realistic Single Image Super-Resolution Using a Generative Adversarial Network | last year | 3140 | cnngansrgan |
WavesGatewayFramework A framework to connect other cryptocurrencies to the Waves platform. | last year | 24 | |
mygpo The gpodder.net webservice | last year | 263 | djangogpodderhacktoberfest |
pyston A faster and highly-compatible implementation of the Python programming language. | last year | 2461 | |
DottedDict Python library that provides a method of accessing lists and dicts with a dotted path notation. | last year | 168 | |
graphql-relay-py A library to help construct a graphql-py server supporting react-relay | last year | 145 | |
dev-setup macOS development environment setup: Easy-to-understand instructions with automated setup scripts for developer tools like Vim, Sublime Text, Bash, iTerm, Python data analysis, Spark, Hadoop MapReduc | last year | 6014 | android-developmentawsbash |
last year | 3 | ||
micropython-scd30 MicroPython I2C driver for SCD30 CO2 sensor module | last year | 23 | |
pandasql sqldf for pandas | last year | 1277 | |
missingno Missing data visualization module for Python. | last year | 3772 | data-analysisdata-visualizationmissing-data |
hamilton A scalable general purpose micro-framework for defining dataflows. THIS REPOSITORY HAS BEEN MOVED TO www.github.com/dagworks-inc/hamilton | last year | 878 | dagdata-engineeringdata-platform |
AMDH Android Mobile Device Hardening | last year | 188 | adbandroidandroid-hardening |
runlike Given an existing docker container, prints the command line necessary to run a copy of it. | last year | 1794 | dockerdocker-containerpython |
neural-networks-and-deep-learning Code samples for my book "Neural Networks and Deep Learning" | last year | 15029 | |
shortuuid A generator library for concise, unambiguous and URL-safe UUIDs. | last year | 1940 | |
pandaSDMX Python interface to SDMX | last year | 118 | |
fuzzywuzzy Fuzzy String Matching in Python | last year | 9029 | |
razi A cheminformatics extension for the SQLAlchemy database toolkit. | last year | 37 | |
mqtt-pwn MQTT-PWN intends to be a one-stop-shop for IoT Broker penetration-testing and security assessment operations. | last year | 318 | exploitationiotmqtt |
kitt The container based portable Shell environment | last year | 16 | bashcontainersdocker |
domato DOM fuzzer | last year | 1635 | domfuzzingsecurity |
micropython-i2c-ultrasonic A MicroPython driver for the RCWL-9620-based M5 I2C Ultrasonic Distance Unit | last year | 1 | |
w3af w3af: web application attack and audit framework, the open source web vulnerability scanner. | last year | 4443 | appseccross-site-scriptingscanner |
collective.workspace Restricted workspaces for Plone | last year | 7 | |
django-cache-machine Automatic caching and invalidation for Django models through the ORM. | last year | 868 | |
aioredis-py asyncio (PEP 3156) Redis support | last year | 2269 | aioredisasynciohacktoberfest |
aioredis-py asyncio (PEP 3156) Redis support | last year | 2277 | aioredisasynciohacktoberfest |
rtv Browse Reddit from your terminal | last year | 4632 | command-linecursespython |
crau Easy-to-use Web archiver | last year | 52 | |
micropyGPS A Full Featured GPS NMEA-0183 sentence parser for use with Micropython and the PyBoard embedded platform | last year | 331 | gpsgps-librarymicropython |
SH1106 MicroPython driver for the SH1106 OLED controller | last year | 145 | |
TensorLayer Deep Learning and Reinforcement Learning Library for Scientists and Engineers | last year | 7280 | a3cartificial-intelligencechatbot |
last year | 7 | micropythonpcf8563 | |
semantic-search-through-wikipedia-with-weaviate Semantic search through a vectorized Wikipedia (SentenceBERT) with the Weaviate vector search engine | last year | 214 | |
PcapViz Visualize network topologies and collect graph statistics based on pcap files | last year | 326 | network-topologypcappython |
python_lcd Python based library for talking to character based LCDs. | last year | 285 | |
skbel SKBEL - Bayesian Evidential Learning framework built on top of scikit-learn. | last year | 20 | bayesian-inferencegaussian-processgaussian-process-regression |
librectf CTF in a box. Minimal setup required. (not production-ready yet) | last year | 80 | |
flask-file-upload Easy file uploads for Flask. | last year | 151 | flaskflask-sqlalchemysqlalchemy |
flask-jwt-router Flask JWT Router is a Python library that adds authorised routes to a Flask app. | last year | 54 | flaskjwtpyjwt |
PyGrid-deprecated---see-PySyft- A Peer-to-peer Platform for Secure, Privacy-preserving, Decentralized Data Science | last year | 611 | peer-to-peerpygridpython |
python-user-agents A Python library that provides an easy way to identify devices like mobile phones, tablets and their capabilities by parsing (browser) user agent strings. | last year | 1393 | browser-detectionpythonuser-agent-detection |
Flask-GraphQL-Auth (UNMAINTAINED. FEEL FREE TO FORK) 🐍A Pythonic way to provide JWT authentication for Flask-GraphQL | last year | 63 | authextensionflask-extension |
Urban_PointCloud_Processing Repository for automatic classification and labeling of Urban PointClouds using data fusion and region growing techniques. | last year | 155 | 2d-data3d-dataclassification |
colorteller-aws-cdk reference for cdk implementation of the sample colorteller app provided by AWS | last year | 3 | |
cioppino.twothumbs Plone product base on like and dislike thumbs | last year | 14 | |
collective.tiles.advancedstatic A tile that shows html text, allowing to add some defined styles, class and other option | last year | 0 | |
fastapi-auth Auth for use with FastAPI | last year | 128 | |
stempeg Python I/O for STEM audio files | last year | 87 | ffmpegmultitracknative-instruments |
alfred-py3-default-browser A modern Alfred workflow for switching the default browser on macOS | last year | 4 | alfredalfred-workflowalfred3-workflow |
mutablesecurity CLI program for automating the setup, configuration, and use of cybersecurity solutions | last year | 41 | cybersecurity-solutionsincident-response-toolingsecurity-automation |
fastapi-jinja Adds integration of the Jinja template language to FastAPI. | last year | 64 | hacktoberfesthacktoberfest2020 |
fastapi-chameleon Adds integration of the Chameleon template language to FastAPI. #pypackage | last year | 133 | |
laikaboss Laika BOSS: Object Scanning System | last year | 720 | |
django-multi-gtfs Django app to import and export General Transit Feed Specification (GTFS) | last year | 50 | |
funfuzz A collection of fuzzers in a harness for testing the SpiderMonkey JavaScript engine. | last year | 615 | fuzzerjavascript-fuzzingjsfunfuzz |
collective.jsonify Provide json representation for content in Plone | last year | 12 | |
micropython-uprotobuf A lightweight implementation of Google's Protocol Buffers (protobuf) for micropython | last year | 19 | |
scikit-rebate A scikit-learn-compatible Python implementation of ReBATE, a suite of Relief-based feature selection algorithms for Machine Learning. | last year | 388 | data-sciencefeature-selectionpython |
ouroboros Automatically update running docker containers with newest available image | last year | 1562 | container-managementcontainersdocker |
imagemounter Command line utility and Python package to ease the (un)mounting of forensic disk images | last year | 111 | |
wagtailembedder Snippets embedder for Wagtail richtext fields | last year | 36 | embedspythonsnippets |