nameupdatedstarsbadges
osmcha

Python package to detect suspicious OSM changesets

4 days ago

40gisopenstreetmaposm
mealie

Mealie is a self hosted recipe manager and meal planner with a RestAPI backend and a reactive frontend application built in Vue for a pleasant user experience for the whole family. Easily add recipes

4 days ago

4515hacktoberfesthacktoberfest2022meal-plans
odoo

Odoo. Open Source Apps To Grow Your Business.

4 days ago

33428appsbusinesserp
core

:house_with_garden: Open source home automation that puts local control and privacy first.

4 days ago

67433asynciohacktoberfesthome-automation
frigate

NVR with realtime local object detection for IP cameras

4 days ago

13712aicameragoogle-coral
mopidy

Mopidy is an extensible music server written in Python

4 days ago

7872mopidymusic-playerpython
sfepy

Main SfePy repository

4 days ago

665
weblate

Web based localization tool with tight version control integration.

4 days ago

4086continuous-localizationcrowdsourcingdjango
panel

Panel: The powerful data exploration & web app framework for Python

4 days ago

3863bokehcontrol-panelsdashboards
librephotos

A self-hosted open source photo management service. This is the repository of the backend.

4 days ago

6381djangoexifhacktoberfest
InvenTree

Description This iOS app integrates natively with the InvenTree open source inventory management and stock control database. With tightly integrated barcode scanning functionality, the app provides

4 days ago

3464djangohacktoberfestpython
bracket

Selfhosted tournament system with web interface

4 days ago

92apibracketbrackets
plantcv

Plant phenotyping with image analysis

4 days ago

598bioinformaticsimage-analysisplant-phenotyping
scipy

SciPy library main repository

4 days ago

12215algorithmsclosemberpython
deepchem

Democratizing Deep-Learning for Drug Discovery, Quantum Chemistry, Materials Science and Biology

4 days ago

4939biologydeep-learningdrug-discovery
searxng

SearXNG is a free internet metasearch engine which aggregates results from various search services and databases. Users are neither tracked nor profiled.

4 days ago

6543hacktoberfestmetasearchmetasearch-engine
firedrake

Firedrake is an automated system for the portable solution of partial differential equations using the finite element method (FEM)

4 days ago

451
flagsmith

Open Source Feature Flagging and Remote Config Service. Host on-prem or use our hosted version at https://flagsmith.com/

4 days ago

3599cdcicontinuous-integration
pandas

Flexible and powerful data analysis / manipulation library for Python, providing labeled data structures similar to R data.frame objects, statistical functions, and much more

4 days ago

41310alignmentdata-analysisdata-science
arviz

Exploratory analysis of Bayesian models with Python

4 days ago

1495bayesianclosemberpython
tracim

Threads, files and pages with status and full history. All in the same place.

4 days ago

198
wave

Realtime Web Apps and Dashboards for Python and R

4 days ago

3810appdashboardhacktoberfest
CityEnergyAnalyst

The City Energy Analyst (CEA)

4 days ago

180
Jarvis

Personal Assistant for Linux and macOS

4 days ago

2842linuxmacospersonal-assistant
gramps-web-api

A RESTful web API for Gramps

4 days ago

62
fava

Fava - web interface for Beancount

4 days ago

1762beancountledgerplaintext-accounting
theoretical-physics

Source code of the Theoretical Physics Reference online book

4 days ago

217bookphysicsreference
jina

☁️ Build multimodal AI applications with cloud-native stack

4 days ago

19697cloud-nativecncfdeep-learning
auto-archiver

Automatically archive links to videos, images, and social media content from Google Sheets (and more).

4 days ago

448archivedockeropen-source-research
OctoBot

Open source crypto trading bot

4 days ago

2661algorithmic-tradingarbitragebacktesting
awx

AWX provides a web-based user interface, REST API, and task engine built on top of Ansible. It is one of the upstream projects for Red Hat Ansible Automation Platform.

4 days ago

13175ansibleautomationawx
saleor

Saleor Core: the high performance, composable, headless commerce API.

4 days ago

19763cartcheckoutcommerce
iguana

Iguana is an open source issue management system with a kanban board.

4 days ago

66activity-streamansibledjango
cookiecutter-django

Cookiecutter Django is a framework for jumpstarting production-ready Django projects quickly.

4 days ago

11363boilerplatecelerycookiecutter
wger

Self hosted FLOSS fitness/workout, nutrition and weight tracker written with Django

4 days ago

2678djangofitnessgym
pytest

The pytest framework makes it easy to write small tests, yet scales to support complex functional testing

4 days ago

11146hacktoberfestpythontest
wikmd

A file based wiki that uses markdown

4 days ago

282dockerdocumentationhtml
numpy

The fundamental package for scientific computing with Python.

4 days ago

25775numpypython
retext

ReText: Simple but powerful editor for Markdown and reStructuredText

4 days ago

1775editormarkdownmarkdown-editor
duecredit

Automated collection and reporting of citations for used software/methods/datasets

4 days ago

231
Arcticons

A monotone line-based icon pack for android

4 days ago

786androidf-droidfdroid
ansible-navigator

A text-based user interface (TUI) for Ansible.

4 days ago

307ansibleansible-commandsansible-dev-tools
mercury

Convert Jupyter Notebooks to Web Apps

4 days ago

3708data-sciencedata-visualizationjupyter
yt

Main yt repository

4 days ago

428analysisastronomyastrophysics
wemake-django-template

Bleeding edge django template focused on code quality and security.

5 days ago

1901caddycookiecuttercookiecutter-template
ansible-doc-extractor

Extract documentation from Ansible modules

5 days ago

16ansibleansible-modulesdocumentation
ArchiveBox

🗃 Open source self-hosted web archiving. Takes URLs/browser history/bookmarks/Pocket/Pinboard/etc., saves HTML, JS, PDFs, media, and more...

5 days ago

19078archiveboxbackupsbookmark-archiver
translate

Useful localization tools with Python API for building localization & translation systems

5 days ago

819gettexthacktoberfesti18n
PySolFC

A comprehensive, feature-rich, open source, and portable, collection of Solitaire games.

5 days ago

424card-gamecardsfreecell-solver
docassemble

A free, open-source expert system for guided interviews and document assembly, based on Python, YAML, and Markdown.

5 days ago

714docassemble
mobility-database-catalogs

The Catalogs of Sources of the Mobility Database.

5 days ago

231
pyvista

3D plotting and mesh analysis through a streamlined interface for the Visualization Toolkit (VTK)

5 days ago

22083dhacktoberfestmesh
zulip

Zulip server and web application. Open-source team chat that helps teams stay productive and focused.

5 days ago

19439apachechatcollaboration

5 days ago

15
WarcDB

WarcDB: Web crawl data as SQLite databases.

5 days ago

382clicrawlingdatabase
docker-stacks

Ready-to-run Docker images containing Jupyter applications

5 days ago

7681dockeripythonipython-notebook
leafmap

A Python package for interactive mapping and geospatial analysis with minimal coding in a Jupyter environment

5 days ago

2861data-sciencedatavizfolium
healthchecks

Open-source cron job and background task monitoring service, written in Python & Django

5 days ago

7068croncron-jobsdevops
discord.py

An API wrapper for Discord written in Python.

5 days ago

14056botdiscorddiscord-api
trimesh

Python library for loading and using triangular meshes.

5 days ago

2659geometrymeshpython
porcupine

On-device wake word detection powered by deep learning

5 days ago

3345handsfreehotwordhotword-detection
edsnlp

Modular, fast NLP framework, compatible with Pytorch and spaCy, offering tailored support for French clinical notes.

5 days ago

94clinical-data-warehousedeep-learningfast
spikeinterface

A Python-based module for creating flexible and robust spike sorting pipelines.

5 days ago

354electrophysiologyneurosciencespike-sorting
markdown

A Python implementation of John Gruber’s Markdown with Extension support.

5 days ago

3520markdownmarkdown-parsermarkdown-to-html
shynet

Modern, privacy-friendly, and detailed web analytics that works without cookies or JS.

5 days ago

2730a17tanalyticsdjango
docker-python

Kaggle Python docker image

5 days ago

2309
iem

Code that makes the Iowa Environmental Mesonet run, or run into the ground.

5 days ago

131iowamesonetweather
python-telegram-bot

We have made you a wrapper you can't refuse

5 days ago

24276botchatbotframework
relate

RELATE is an Environment for Learning And TEaching

5 days ago

358code-homeworkcode-questioncourse-management
cclib

Parsers and algorithms for computational chemistry logfiles

5 days ago

300computational-chemistryhacktoberfestpython
pymor

pyMOR - Model Order Reduction with Python

5 days ago

265control-systemsdata-drivendealii

5 days ago

6algokit-template
algokit-cli

The Algorand AlgoKit CLI is the one-stop shop tool for developers building on the Algorand network.

5 days ago

140
fipy

FiPy is a Finite Volume PDE solver written in Python

5 days ago

455materials-sciencemodelingpartial-differential-equations
antimeridian

Fix GeoJSON polygons that cross the antimeridian

5 days ago

28antimeridiangeojsongeospatial
python-mapnik

Python bindings for mapnik

5 days ago

152
INGInious

INGInious is a secure and automated exercises assessment platform using your own tests, also providing a pluggable interface with your existing LMS.

5 days ago

187assessmentautogradingcoding-interviews
rapidbay

Self-hosted torrent video streaming service compatible with Chromecast, AppleTV & Kodi deployable in the cloud

5 days ago

659appleapple-tvchromecast
freecell4maemo

port of freecell app from nokia n900 to android

5 days ago

1
pyinfra

pyinfra automates infrastructure using Python. It’s fast and scales from one server to thousands. Great for ad-hoc command execution, service deployment, configuration management and more.

5 days ago

2495cloud-managementconfiguration-managementhigh-performance
nova-utils

Metadata & configs for client apps in Polkadot & Kusama ecosystem

6 days ago

13blockchaindappspolkadot
docker-android

Android in docker solution with noVNC supported and video recording

6 days ago

6822alibabacloudandroidandroid-emulator
zarr-python

An implementation of chunked, compressed, N-dimensional arrays for Python.

6 days ago

1300compressedhacktoberfestndimensional-arrays
awesome-quant

A curated list of insanely awesome libraries, packages and resources for Quants (Quantitative Finance)

6 days ago

15199algorithmic-trading-enginealgorithmic-trading-libraryalgotrading
selene

User-oriented Web UI browser tests in Python

6 days ago

653automatione2e-testingpython
sopel

:robot::speech_balloon: An easy-to-use and highly extensible IRC Bot framework. Formerly Willie.

6 days ago

946hacktoberfestircirc-bot
ansible-playbook-grapher

A command line tool to create a graph representing your Ansible playbook tasks and roles

6 days ago

526ansibleansible-playbookansible-role
pycytominer

Python package for processing image-based profiling data

6 days ago

62carpenter-labcellprofilercytominer
Adafruit_CircuitPython_MiniMQTT

MQTT Client Library for CircuitPython

6 days ago

68circuitpythonhacktoberfestmqtt
otterwiki

A minimalstic wiki powered by python, markdown and git.

6 days ago

106markdownwiki
Bitpoll

A web application for scheduling meetings and general polling.

6 days ago

214djangopollingpython3
ansible-lint

ansible-lint checks playbooks for practices and behavior that could potentially be improved and can fix some of the most common ones for you

6 days ago

3272ansibleansible-dev-toolsansible-lint
whoogle-search

A self-hosted, ad-free, privacy-respecting metasearch engine

6 days ago

8526adblockdockereasy-deploy
django-wiki

A wiki system with complex functionality for simple integration and a superb interface. Store your knowledge with style: Use django models.

6 days ago

1752djangodjango-wikipython
openstack-ansible

Ansible playbooks for deploying OpenStack. Mirror of code maintained at opendev.org.

6 days ago

1408
jupyter-ai

A generative AI extension for JupyterLab

6 days ago

2664generative-aijupyterjupyterlab
nbgrader

A system for assigning and grading notebooks

6 days ago

1246gradingjupyterjupyter-notebook
python-slack-sdk

Slack Developer Kit for Python

6 days ago

3760aiohttpaiohttp-clientasyncio
android

Delta Icons for Android

6 days ago

4942023androidcustomization
babel

The official repository for Babel, the Python Internationalization Library

6 days ago

1239hacktoberfest
ariadne

Python library for implementing GraphQL servers using schema-first approach.

6 days ago

2119apiapollo-graphqlapollo-python
zim-desktop-wiki

Main repository of the zim desktop wiki project

6 days ago

1829
mayavi

3D visualization of scientific data in Python

6 days ago

1209
jupyter-book

Create beautiful, publication-quality books and documents from computational content.

6 days ago

3633documentation-generatorjupytersphinx-doc
wagtail-content-import

A module for importing page content into Wagtail from third-party sources. Docs:

6 days ago

32
fusesoc

Package manager and build abstraction tool for FPGA/ASIC development

6 days ago

1081edafpgapackage-manager
changedetection.io

The best and simplest free open source website change detection, website watcher, restock monitor and notification service. Restock Monitor, change detection. Designed for simplicity - Simply monitor

6 days ago

14260back-in-stockchange-alertchange-detection
colorcet

A set of useful perceptually uniform colormaps for plotting scientific data

7 days ago

650bokehcolorcetcolormaps
osmcha-django

A database manager and API for OSMCha

7 days ago

33djangogisopenstreetmap
Nominatim

Open Source search based on OpenStreetMap data

7 days ago

2795geocodingopenstreetmaposm
IOPaint

Image inpainting tool powered by SOTA AI Model. Remove any unwanted object, defect, people from your pictures or erase and replace(powered by stable diffusion) any thing on your pictures.

7 days ago

15923inpaintinglamalatent-diffusion
dpaste

The Django project driving dpaste.org

7 days ago

499djangodockerpastebin
voila

Voilà turns Jupyter notebooks into standalone web applications

7 days ago

5114dashboardingjupyterjupyter-notebook
AgML

AgML is a centralized framework for agricultural machine learning. AgML provides access to public agricultural datasets for common agricultural deep learning tasks, with standard benchmarks and pretra

7 days ago

136agriculturecomputer-visiondataset
jupytext

Jupyter Notebooks as Markdown Documents, Julia, Python or R scripts

7 days ago

6351hydrogenjupyter-notebookjupyterlab
babybuddy

A :baby: buddy to help caregivers track sleep, feedings, diaper changes, and tummy time to learn about and predict baby's needs without (as much) guess work.

7 days ago

1857babydashboarddjango
reviewboard

An extensible and friendly code review tool for projects and companies of all sizes.

7 days ago

1526code-reviewcodereviewdeveloper-tools
weewx

WeeWX code repository

7 days ago

957fine-offsetpythonraspberry-pi
GraphCrawler

GraphQL automated security testing toolkit

7 days ago

277apiapi-hackingautomated-testing
dedalus

A flexible framework for solving PDEs with modern spectral methods.

7 days ago

415fluid-dynamicspde-solverspectral-methods
LibreTranslate

Free and Open Source Machine Translation API. Self-hosted, offline capable and easy to setup.

7 days ago

6186apimachinetranslate
internetarchive

A Python and Command-Line Interface to Archive.org

7 days ago

1472
elyra

Elyra extends JupyterLab with an AI centric approach.

7 days ago

1741aiairflowanaconda
ploomber

The fastest ⚡️ way to build data pipelines. Develop iteratively, deploy anywhere. ☁️

7 days ago

3334data-engineeringdata-sciencejupyter
graphql-core

A Python 3.6+ port of the GraphQL.js reference implementation of GraphQL.

7 days ago

493apiasynciographene
maloja

Self-hosted music scrobble database to create personal listening statistics and charts

7 days ago

891chartslistening-habitsmusic
tealish

Tealish: A readable language for Algorand

7 days ago

87algorandalgorand-tealavm
Charcoal

A concise language for sketching ASCII art.

7 days ago

202ascii-artesoteric-languagegolfing-language
vedo

A python module for scientific analysis of 3D data based on VTK and Numpy

7 days ago

18713d3d-graphicsdolfin
lotus

Open Source Pricing & Packaging Infrastructure

8 days ago

1609analyticsapibilling
inql

InQL is a robust, open-source Burp Suite extension for advanced GraphQL testing, offering intuitive vulnerability detection, customizable scans, and seamless Burp integration.

8 days ago

1420api-documentation-toolbugbountybugbounty-tool
klaus

docker run klaus / pip install klaus — the first Git web viewer that Just Works™.

8 days ago

667gitpythonzero-configuration
gtfs_segments

GTFS Segments: A fast and efficient library to generate bus stop spacings

8 days ago

16busdistributiongtfs-feed
pokeapi

The Pokémon API

8 days ago

3873apibeginner-friendlygraphql
timetagger

Tag your time, get the insight

8 days ago

860pythontimetracker
xontrib-jupyter

Xonsh jupyter kernel allows to run Xonsh shell code in Jupyter, JupyterLab, Euporia, etc.

8 days ago

25euporiejupyterjupyter-extension
meshio

:spider_web: input/output for many mesh formats

8 days ago

1744engineeringmathematicsmesh
mdformat

CommonMark compliant Markdown formatter

8 days ago

318clicodeformattercommonmark
markdown-it-py

Markdown parser, done right. 100% CommonMark support, extensions, syntax plugins & high speed. Now in Python!

8 days ago

594markdownmarkdown-itmarkdown-parser
salt-sproxy

Salt plugin to automate the management and configuration of (network) devices at scale, without running (Proxy) Minions.

8 days ago

112automationconfiguration-managementdocker
OctoPrint

OctoPrint is the snappy web interface for your 3D printer!

8 days ago

79193d-printeroctoprintpython
vpype

The Swiss-Army-knife command-line tool for plotter vector graphics.

8 days ago

640generative-arthacktoberfesthacktoberfest2020
jupyterlab_templates

Support for jupyter notebook templates in jupyterlab

8 days ago

361data-sciencedatavizjupyter
gtfs_functions

Package with useful functions to create geo-spatial visualizations from a GTFS.

8 days ago

85
shenfun

High performance computational platform in Python for the spectral Galerkin method

8 days ago

174chebyshevcurvilinear-coordinatescylindrical-coordinates
ihatemoney

A simple shared budget manager web application

9 days ago

1065budget-managerflaskpython
user-statistician

Generate a GitHub stats SVG for your GitHub Profile README in GitHub Actions

9 days ago

71actionsactivitycontributions
ansible-doctor

Annotation based documentation for your Ansible roles

9 days ago

103ansibleautomationdocumentation
ansible-later

Another best practice scanner for Ansible roles and playbooks

9 days ago

95ansibleautomationlint
ipytest

Pytest in IPython notebooks.

9 days ago

280ipython-notebookjupyter-notebookpytest
molten-nvim

A neovim plugin for interactively running code with the jupyter kernel. Fork of magma-nvim with improvements in image rendering, performance, and more

10 days ago

213code-runnerjupyterneovim
airflow

Apache Airflow - A platform to programmatically author, schedule, and monitor workflows

10 days ago

33544airflowapacheapache-airflow
scikit-learn

scikit-learn: machine learning in Python

10 days ago

57413data-analysisdata-sciencemachine-learning
keras

Deep Learning for humans

10 days ago

60316data-sciencedeep-learningjax
backtrader

Python Backtesting library for trading strategies

10 days ago

12538backtestingmetaclasspython
coq_nvim

Fast as FUCK nvim completion. SQLite, concurrent scheduler, hundreds of hours of optimization.

10 days ago

3293completionneovimneovim-plugin
graphene

GraphQL framework for Python

10 days ago

7922frameworkgraphenegraphql
openage

Free (as in freedom) open source clone of the Age of Empires II engine :rocket:

10 days ago

12268age-of-empiresc-plus-pluscmake
yt-dlp

A youtube-dl fork with additional features and fixes

10 days ago

66278pythonsponskrubsponsorblock
numpyro

Probabilistic programming with NumPy powered by JAX for autograd and JIT compilation to GPU/TPU/CPU.

10 days ago

1993bayesian-inferencehmcinference-algorithms
optax

Optax is a gradient processing and optimization library for JAX.

10 days ago

1364
mythril

Security analysis tool for EVM bytecode. Supports smart contracts built for Ethereum, Hedera, Quorum, Vechain, Roostock, Tron and other EVM-compatible blockchains.

10 days ago

3663blockchainethereumprogram-analysis
joliGEN

Generative AI Image Toolset with GANs and Diffusion for Real-World Applications

10 days ago

185augmented-realitydeep-learningdiffusion-models
jrnl

Collect your thoughts and notes without leaving the command line.

10 days ago

6182clicommand-lineencrypted
awpy

awpy is a Python library to parse, analyze and visualize Counter-Strike: Global Offensive (CSGO) data

10 days ago

335counter-strikecounter-strike-global-offensivecsgo
dagster

An orchestration platform for the development, production, and observation of data assets.

10 days ago

9638analyticsdagsterdata-engineering
hasty-paste

A fast and minimal paste bin.

10 days ago

183asynchronousasynciodocker
catcli

The command line catalog tool for your offline data

10 days ago

191catalogcommandlineindexer
codespell

check code for common misspellings

10 days ago

1632
diffrax

Numerical differential equation solvers in JAX. Autodifferentiable and GPU-capable. https://docs.kidger.site/diffrax/

10 days ago

1154deep-learningdifferential-equationsdynamical-systems
osmnx

OSMnx is a Python package to easily download, model, analyze, and visualize street networks and other geospatial features from OpenStreetMap.

10 days ago

4576geographygeospatialgis
terminator

multiple GNOME terminals in one window

10 days ago

1893gnomegtklinux
memory_profiler

Monitor Memory usage of Python code

10 days ago

4155
dnfdragora

dnfdragora is a dnf frontend based on libyui abstraction

10 days ago

124dnffedoralibyui-mga
git-filter-repo

Quickly rewrite git repository history (filter-branch replacement)

10 days ago

7041
python-markdown2

markdown2: A fast and complete implementation of Markdown in Python

10 days ago

2564
oelint-adv

Advanced oelint

10 days ago

47bitbakeopenembeddedqatools
slither

Static Analyzer for Solidity and Vyper

10 days ago

4858ethereumsoliditystatic-analysis
biopython

Official git repository for Biopython (originally converted from CVS)

10 days ago

4074bioinformaticsbiopythondna
pyqtgraph

Fast data visualization and GUI tools for scientific / engineering applications

10 days ago

3592hacktoberfestnumpypython
RecoverPy

Interactively find and recover deleted or :point_right: overwritten :point_left: files from your terminal

10 days ago

1139cliconsolecybersecurity
dbt-core

dbt enables data analysts and engineers to transform their data using the same practices that software engineers use to build applications.

10 days ago

8510analyticsbusiness-intelligencedata-modeling
khmer

In-memory nucleotide sequence k-mer counting, filtering, graph traversal and more

10 days ago

729bioinformaticsbloom-filtercount-min-sketch
smart_open

Utils for streaming large files (S3, HDFS, gzip, bz2...)

10 days ago

3037botobz2file
scikit-learn-intelex

Intel(R) Extension for Scikit-learn is a seamless way to speed up your Scikit-learn application

10 days ago

1128ai-inferenceai-machine-learningai-training
autoflake

Removes unused imports and unused variables as reported by pyflakes

10 days ago

841formatterhacktoberfestlinter
evennia

Python MUD/MUX/MUSH/MU* development system

10 days ago

1690baseddjangoengine
mkchromecast

Cast macOS and Linux Audio/Video to your Google Cast and Sonos Devices

11 days ago

2145alsaaudiocast-audio
calibre

The official source code repository for the calibre ebook manager

11 days ago

17764calibreebookebook-formats
hail

Cloud-native genomic dataframes and batch computing

11 days ago

915bioinformaticsgeneticsgenomics
slowapi

A rate limiter for Starlette and FastAPI

11 days ago

910asgifastapipython
buku

:bookmark: Personal mini-web in text

11 days ago

6027bookmarkbookmark-managerbookmarks
sparkmagic

Jupyter magics and kernels for working with remote Spark clusters

11 days ago

1275clusterjupyterjupyter-notebook
td-cli

A todo command line todo manager ✔️

11 days ago

182tdtd-clitodo
fastapi-nano

🐍 Simple FastAPI template employing divisional architecture pattern

11 days ago

769
docker-py

A Python library for the Docker Engine API

11 days ago

6559dockerdocker-engine-apidocker-swarm
branch-protection-bot

A bot tool to disable and re-enable "Include administrators" option in branch protection

11 days ago

72actionsbotbranch
numalogic

Collection of operational time series ML models and tools

11 days ago

157autoencodersdeep-learninghacktoberfest
freedoom

Freedoom is an entirely free software game based on the Doom engine.

11 days ago

943

11 days ago

261datadata-lineagedata-science
django-cache-machine

Automatic caching and invalidation for Django models through the ORM.

last year

868
aioredis-py

asyncio (PEP 3156) Redis support

last year

2269aioredisasynciohacktoberfest
aioredis-py

asyncio (PEP 3156) Redis support

last year

2277aioredisasynciohacktoberfest
rtv

Browse Reddit from your terminal

last year

4627command-linecursespython
crau

Easy-to-use Web archiver

last year

50
micropyGPS

A Full Featured GPS NMEA-0183 sentence parser for use with Micropython and the PyBoard embedded platform

last year

319gpsgps-librarymicropython
SH1106

MicroPython driver for the SH1106 OLED controller

last year

145
TensorLayer

Deep Learning and Reinforcement Learning Library for Scientists and Engineers

last year

7265a3cartificial-intelligencechatbot

last year

7micropythonpcf8563
semantic-search-through-wikipedia-with-weaviate

Semantic search through a vectorized Wikipedia (SentenceBERT) with the Weaviate vector search engine

last year

214
PcapViz

Visualize network topologies and collect graph statistics based on pcap files

last year

317network-topologypcappython
python_lcd

Python based library for talking to character based LCDs.

last year

285
skbel

SKBEL - Bayesian Evidential Learning framework built on top of scikit-learn.

last year

20bayesian-inferencegaussian-processgaussian-process-regression
librectf

CTF in a box. Minimal setup required. (not production-ready yet)

last year

80
flask-file-upload

Easy file uploads for Flask.

last year

151flaskflask-sqlalchemysqlalchemy
flask-jwt-router

Flask JWT Router is a Python library that adds authorised routes to a Flask app.

last year

54flaskjwtpyjwt
PyGrid-deprecated---see-PySyft-

A Peer-to-peer Platform for Secure, Privacy-preserving, Decentralized Data Science

last year

612peer-to-peerpygridpython
python-user-agents

A Python library that provides an easy way to identify devices like mobile phones, tablets and their capabilities by parsing (browser) user agent strings.

last year

1393browser-detectionpythonuser-agent-detection
Flask-GraphQL-Auth

(UNMAINTAINED. FEEL FREE TO FORK) 🐍A Pythonic way to provide JWT authentication for Flask-GraphQL

last year

63authextensionflask-extension
Urban_PointCloud_Processing

Repository for automatic classification and labeling of Urban PointClouds using data fusion and region growing techniques.

last year

1462d-data3d-dataclassification
colorteller-aws-cdk

reference for cdk implementation of the sample colorteller app provided by AWS

last year

3
cioppino.twothumbs

Plone product base on like and dislike thumbs

last year

14
collective.tiles.advancedstatic

A tile that shows html text, allowing to add some defined styles, class and other option

last year

0

last year

4
fastapi-auth

Auth for use with FastAPI

last year

128

last year

0
stempeg

Python I/O for STEM audio files

last year

87ffmpegmultitracknative-instruments
alfred-py3-default-browser

A modern Alfred workflow for switching the default browser on macOS

last year

4alfredalfred-workflowalfred3-workflow
mutablesecurity

CLI program for automating the setup, configuration, and use of cybersecurity solutions

last year

39cybersecurity-solutionsincident-response-toolingsecurity-automation
pysmi

SNMP MIB parser

last year

2
fastapi-jinja

Adds integration of the Jinja template language to FastAPI.

last year

64hacktoberfesthacktoberfest2020
fastapi-chameleon

Adds integration of the Chameleon template language to FastAPI. #pypackage

last year

133
laikaboss

Laika BOSS: Object Scanning System

last year

716
django-multi-gtfs

Django app to import and export General Transit Feed Specification (GTFS)

last year

50
iterm2-tabs.zsh

Andy's zsh plugin for setting iTerm2 titles and colors

last year

7iterm2zsh-plugin
funfuzz

A collection of fuzzers in a harness for testing the SpiderMonkey JavaScript engine.

last year

615fuzzerjavascript-fuzzingjsfunfuzz
collective.jsonify

Provide json representation for content in Plone

last year

12
micropython-uprotobuf

A lightweight implementation of Google's Protocol Buffers (protobuf) for micropython

last year

19
scikit-rebate

A scikit-learn-compatible Python implementation of ReBATE, a suite of Relief-based feature selection algorithms for Machine Learning.

last year

388data-sciencefeature-selectionpython
ouroboros

Automatically update running docker containers with newest available image

last year

1562container-managementcontainersdocker
imagemounter

Command line utility and Python package to ease the (un)mounting of forensic disk images

last year

109
wagtailembedder

Snippets embedder for Wagtail richtext fields

last year

36embedspythonsnippets
ledgerhelpers

A collection of helper programs and a helper library for Ledger (ledger-cli)

last year

94
catkin_lint

Check catkin packages for common errors

last year

56catkinpythonros
mir_robot

ROS support for the MiR Robots. This is a community project to use the MiR Robots with ROS. It is not affiliated with Mobile Industrial Robots.

last year

178
datajob

Build and deploy a serverless data pipeline on AWS with no effort.

last year

107awsaws-cdkdata-pipeline
epr

CLI Epub Reader

last year

1101cliebookepub
ganimede

Store,Version and Run jupyter notebook via ReST api

last year

5fastapijupyterjupyter-notebook
ledger-autosync

Synchronize your ledger-cli files with your bank.

last year

255accountingledgerofx
typilus

Code for "Typilus: Neural Type Hints" PLDI 2020

last year

52
botostubs

boto3 code assistance for any API in any IDE, always up to date

last year

95boto3codecompletion
MicroPython-ADC_Cal

MicroPython ESP32 library for calibrated on-chip ADC conversion

last year

17esp32micropythonmicropython-esp32
easy_perception_deployment

A ROS2 package that accelerates the training and deployment of CV models for industries.

last year

51
modelzoo

A collection of machine-learned models for use in autonomous driving applications.

last year

59autonomous-drivingautowaremachine-learning
astrobase

Create kubernetes clusters quickly on GCP, AWS, or Azure.

last year

56astrobaseawsazure
txmongo

asynchronous python driver for mongo

last year

337python
uPy_APDS9960

Micropython proximitiy library for esp8266 using APDS9960

last year

7
zsh-easy-motion

Vim's easy-motion for zsh

last year

42
fastapi-opentracing

fastapi opentracing middleware works on k8s

last year

21
micropython-ws2812

MicroPython driver for WS2812 RGB LEDs (WS2812B, AdaFruit NeoPixels, ...).

last year

180
Det3D

A general 3D object detection codebse.

last year

14293d-object-detectionautonomous-drivingdeep-learning
SHT30

MicroPython driver for the SHT3x sensor.

last year

0
delorean

Delorean: Time Travel Made Easy

last year

1842datedatetimedatetimes
python-algorithms

Algorithms implemented in Python

last year

269
coax

Modular framework for Reinforcement Learning in python

last year

150reinforcement-learningreinforcement-learning-agentreinforcement-learning-algorithms
deltapv

A photovoltaic simulator with automatic differentiation

last year

51
micropython-stepper

Library to use stepper drivers in micropython in a tidy way

last year

3
shellbags

Cross-platform, open-source shellbag parser

last year

147
ContrastiveExplanation

Contrastive Explanation (Foil Trees), developed at TNO/Utrecht University

last year

43contrastive-explanationsexplainable-aifoil
marker

The terminal command palette

last year

2002
pkgbuilder

An AUR helper (and library) in Python 3.

last year

66
hBPF

hBPF = eBPF in hardware

last year

378ebpffpgalitex
ai-imu-dr

AI-IMU Dead-Reckoning

last year

688imuinertial-odometrylocalization
kicad_footprints

A collection of all the KiCad footprints on the internet

last year

300electronicskicadkicad-footprints
noto-fonts

Noto fonts, except for CJK and emoji

last year

2438
geojson-indoor-tools

Quick tools for editing GeoJSON files

last year

3geojsonindoor-maps
zopyx.ipsumplone

Sample content for Plone sites

last year

2
lambda-refarch-fileprocessing

Serverless Reference Architecture for Real-time File Processing

last year

451
lightnlg

A minimalistic codebase for training NLG models from HuggingFace Transformers using PyTorch Lightning.

last year

3bartgenerationgpt-2
tftb

A Python module for time-frequency analysis

last year

247matplotlibnumpypython
sd-material-ui

material-ui components for Dash

last year

187dashmaterial-uiplotly-dash
ggpy

ggplot port for python

last year

3677
MicroPythonBLEHID

Human Interface Device (HID) over Bluetooth Low Energy (BLE) GATT library for MicroPython.

last year

161hidjoystickkeyboard
fapro

Fake Protocol Server

last year

1484elasticsearchftpimap
projecttier.org

Wagtail website for Project TIER

last year

10agpldjangoeducation
SA-cim_vladiator

Data validator agains Splunk Common Information Model (CIM)

last year

70
collective.consent

Provides a functionality to ask users for consent to different topics, before they can continue.

last year

1hacktoberfest
three.py

Python 3D library.

last year

107
gluon-cv

Gluon CV Toolkit

last year

5669action-recognitioncomputer-visiondeep-learning
OIDrage

A lightweight SNMP server for testing purposes. Sends very limited responses of test data. Designed to scale.

last year

3
open_street_map

Experimental packages for ROS access to Open Street Map information

last year

76
MicroWebSrv

A micro HTTP Web server that supports WebSockets, html/python language templating and routing handlers, for MicroPython (used on Pycom modules & ESP32)

last year

621captive-portalesp32hc2
autopep8

A GitHub action for autopep8, a tool that automatically formats Python code to conform to the PEP 8 style guide.

last year

83autopep8formattergithub-action
micropython-mcp9808

MicroPython driver for the Microchip MCP9808 temperature sensor

last year

6
combobulator

Dependency Combobulator

last year

85dependency-confusionsdlcsecure-coding
micropython-urouter

A lightweight HTTP request routing processing support library based on micropython. The previous name was micro-route

last year

38
micropython-urouter

A lightweight HTTP request routing processing support library based on micropython. The previous name was micro-route

last year

44
monit-docker

Monitor docker containers resources usage and execute docker commands or inside containers

last year

33containerdockermanagement
haros

H(igh) A(ssurance) ROS - Static analysis of ROS application code.

last year

183quality-assuranceroboticsros
SimpleCV

The Open Source Framework for Machine Vision

last year

2642computer-visioncvimage-processing
micropython-buzzer

A buzzer implmention for micropython that can play nokia compose and midi files

last year

14
micropython-aiolora

MicroPython library for controlling a Semtech SX127x LoRa module with asyncio API.

last year

2
pyloudnorm

Flexible audio loudness meter in Python with implementation of ITU-R BS.1770-4 loudness algorithm

last year

526
micropython-aioweb

A minimalist asyncio web framework for MicroPython.

last year

25asyncioesp32http
slacker-cli

Messages to slack from command line

last year

185command-linepythonslack
micropython-tinyrtc-i2c

MicroPython driver for TinyRTC I2C modules with DS1307 RTC and AT24C32N EEPROM

last year

60at24c32ds1307eeprom
django-htmlmin

HTML minifier for Python frameworks (not only Django, despite the name).

last year

542hacktoberfest
nozzlr

Nozzlr is a bruteforce framework, trully modular and script-friendly

last year

63bruteforceinfosecpentesting
loraE22

A MicroPython class for the Ebyte E22 Series LoRa modules

last year

7gpsloramicropython
salt-gen-resource

Generate Rundeck node resources from the Salt Mine

last year

8
brat

brat rapid annotation tool (brat) - for all your textual annotation needs

last year

1753
tensortrade

An open source reinforcement learning framework for training, evaluating, and deploying robust trading agents.

last year

4317
TResNet

Official Pytorch Implementation of "TResNet: High-Performance GPU-Dedicated Architecture" (WACV 2021)

last year

455accuracyarchitectureimagenet
Metrics

Machine learning evaluation metrics, implemented in Python, R, Haskell, and MATLAB / Octave

last year

1606
meza

A Python toolkit for processing tabular data

last year

406csvdataexcel
alfred-workflow

Full-featured library for writing Alfred 3 & 4 workflows

last year

2950alfredalfred-3alfred-workflow
pcf8574

MicroPython module for work with PCF8574(A) I2C 8-bit I/O expander from NXP

last year

0i2cioexpandermicropython
html2text

Convert HTML to Markdown-formatted text.

last year

1524markdownmarkdown-parserpython
uMail

A lightweight, scalable SMTP client for sending email in MicroPython

last year

67
django-inertia-demo

PINGCRM WIP in Django

last year

39
dart-sublime-bundle

Sublime Text 3 Dart Package

last year

263
ipygany

3-D Scientific Visualization in the Jupyter Notebook

last year

478
micropython-ppm_reader

A micropython library to decode PPM signals coming from a RC receiver

last year

8micropythonppmrc-receiver
wagalytics

A Google Analytics dashboard in your Wagtail admin

last year

211google-analyticswagtail
ands

Algorithms and data structures for educational, demonstrational and experimental purposes.

last year

54algorithmscomputer-sciencedata-structures
lifetimes

Lifetime value in Python

last year

1418data-sciencepythonstatistics
tinydns

Very simple DNS async server for micropython

last year

29dnsdns-servermicropython
redturtle.gallery

Plone addon that adds a gallery view with a carousel made with slick.

last year

2
valideer

Lightweight data validation and adaptation Python library.

last year

265
algorealm

Claim the 👑 Crown and the 🪄 Sceptre of Algorand Realm

last year

18algorandalgorand-atomic-transferalgorand-smart-contract
smart-asa

Smart ASA reference implementation

last year

31algorandalgorand-smart-contractalgorand-standard-assets
hyperas

Keras + Hyperopt: A very simple wrapper for convenient hyperparameter optimization

last year

2160hyperopthyperparameter-optimizationkeras
aeneas

aeneas is a Python/C library and a set of tools to automagically synchronize audio and text (aka forced alignment)

last year

2305alignmentaudiocli
robotframework-snmplibrary

SnmpLibrary for Robot Framework

last year

12pythonrobotframeworksnmp

last year

6
pas.plugins.headers

PAS plugin for authentication based on request headers

last year

1
nagios-plugin-mongodb

A Nagios plugin to check the status of MongoDB

last year

346
kitti2bag

Convert KITTI dataset to ROS bag file the easy way!

last year

662converterkittikitti-data
neupy

NeuPy is a Tensorflow based python library for prototyping and building neural networks

last year

739artificial-neural-networksboltzmann-machinedeep-learning
zsh-completion-generator

Plugin that generates completion functions automatically from getopt-style help texts

last year

252zsh-completionszsh-plugins
flask-graphql

Adds GraphQL support to your Flask application.

last year

1319flaskflask-applicationgraphene
WiFiManager

WiFi manager for ESP8266 - ESP12 - ESP32 - micropython

last year

312esp32esp8266espressif
channelstream

Channelstream is a websocket communication server for web applications

last year

59asyncbroadcastchat
alfred-ssh

SSH workflow for Alfred for Mac with powerful hostname expansion/completion

last year

106alfredalfred-workflowiterm2
DeepQA

My tensorflow implementation of "A neural conversational model", a Deep learning based chatbot

last year

2921chatbotdeep-learningseq2seq
MicroPython-ST7735

ST7735 TFT LCD driver for MicroPython

last year

145micropythonmicropython-esp32
LaTeXTools

LaTeX plugin for Sublime Text 2 and 3

last year

1993
sound_field_analysis-py

Analyze, visualize, and process sound field data recorded by spherical microphone arrays.

last year

82analysispackagepython
jupyter-panel-proxy

Jupyter Server Proxy for Panel

last year

11
silverstrike

Finance Management Made Easy

last year

401djangofinancefinance-management
domain_analyzer

Analyze the security of any domain by finding all the information possible. Made in python.

last year

1835
jordijoan.me

Personal blog site using Wagtail CMS

last year

20
collective.fingerpointing

Keep track of different events and write them down to an audit log.

last year

4
HomePWN

HomePwn - Swiss Army Knife for Pentesting of IoT Devices

last year

802blehackiot
collective.dexteritytextindexer

Dynamic SearchableText index for dexterity content types

last year

9
homematic-gqls

A GraphQL wrapper to monitor/control Homematic IP components via REST API.

last year

1flaskgraphqlhomematic
Quads

Computer art based on quadtrees.

last year

1153
wagtail_cache_block

Quickly Add HTML fragment cache to your StreamField block

last year

6streamfieldwagtail
django-wagtail-feeds

Adds support for RSS and JSON Feeds to your Wagtail CMS Projects

last year

56
cleanflux

:wind_chime: A powerful HTTP proxy for InfluxDB /query endpoint

last year

33grafanagrafana-influxdbinfluxdb
dash-recession-report-demo

Dash demo of the NYTimes "Recession in 255 Charts" report

last year

16
CaTeX

Concatenates LaTeX documents.

last year

9
draw-compose

Render Docker compose files.

last year

88
micropython-radio

Simple way to use an nRF24L01 radio to exchange arbitrary Python objects between two Pyboards

last year

51embeddedmicropythonnrf24l01
Katari

Katari - Python Session Initiated Protocol Framework

last year

33asteriskavayabroadsoft
Katari

Katari - Python Session Initiated Protocol Framework

last year

33asteriskavayabroadsoft
create-tf-app

Set up and maintain a machine learning project in Tensorflow with a single script.

last year

4climachine-learningshell-script
sht85

MicroPython module for work with Humidity and Temperature Sensor SHT85.

last year

0humiditymicropythonsensor
micropython-firebase-firestore

Firebase Firestore implementation for Micropython.

last year

8
streamz

Real-time stream processing for python

last year

1208asyncpythonreal-time
deep-learning-roadmap

:satellite: All You Need to Know About Deep Learning - A kick-starter

last year

4519deep-learningresources
spotlight

Deep recommender models using PyTorch.

last year

2919deep-learninglearning-to-rankmachine-learning
LiDAR-MOS

(LMNet) Moving Object Segmentation in 3D LiDAR Data: A Learning-based Approach Exploiting Sequential Data (RAL/IROS 2021)

last year

517deep-learningdeep-neural-networksdynamic-slam
USBPcapOdinDumper

Some set of scripts to unpack odin packets into separate files

last year

5heimdallkaitai-structloke
hypatia

Python searching and indexing library.

last year

29
bayesloop

Probabilistic programming framework that facilitates objective model selection for time-varying parameter models.

last year

134anomaly-detectionbayesian-inferencemodel-selection
nupic

Numenta Platform for Intelligent Computing is an implementation of Hierarchical Temporal Memory (HTM), a theory of intelligence based strictly on the neuroscience of the neocortex.

last year

6325artificial-intelligencehierarchical-temporal-memorymachine-intelligence
chopshop

Protocol Analysis/Decoder Framework

last year

485

last year

89

last year

77
OWOD

(CVPR 2021 Oral) Open World Object Detection

last year

1000continual-learningcontrastive-learningcvpr
python-manhole

Debugging manhole for python applications.

last year

357debuggingpython
pokemon-reverse-engineering-tools

Tools for building and disassembling Pokémon Red and Pokémon Crystal

last year

316disassemblypokemonpython
resampy

Efficient sample rate conversion in python

last year

235audiodspnyucds
CoolScripts

This repository holds cool scripts that we use and want you to use as wel

last year

20
audio-diffusion-pytorch

Audio generation using diffusion models, in PyTorch.

last year

551artificial-intelligenceaudio-generationdeep-learning
Time-MIDI-sender

Sends MIDI notes according to a file. Made for use with DasLight

last year

1
detextify

Remove text from AI-generated images

last year

13
rtei

Right to Education Index website

last year

15
homeassistant-config

Description Control and monitor your home from anywhere in the world. Home Assistant Companion lets you control all your devices and provides advanced location and notification engines to allow for

last year

1811home-assistant-config
Petrel

Tools for writing, submitting, debugging, and monitoring Storm topologies in pure Python

last year

247
cross_compile

A tool to build ROS and ROS2 workspaces for various targets

last year

174
moto

A library that allows you to easily mock out tests based on AWS infrastructure.

last year

6274awsbotoec2
chatGPT-discord-bot

Integrate ChatGPT into your own discord bot

last year

229chatgptdiscord-bot
ChatGPT

Lightweight package for interacting with ChatGPT's API by OpenAI. Uses reverse engineered official API.

last year

6545chatgptcligpt-3
graph_nets

Build Graph Nets in Tensorflow

last year

5303artificial-intelligencedeep-learninggraph-networks
coach

Reinforcement Learning Coach by Intel AI Lab enables easy experimentation with state of the art Reinforcement Learning algorithms

last year

2296carlacoachdeep-learning
awesome-dash

A curated list of awesome Dash (plotly) resources

last year

1990awesomeawesome-listplotly
pandas-profiling

Create HTML profiling reports from pandas DataFrame objects

last year

9903big-data-analyticsdata-analysisdata-exploration
tensorflow-shakespeare

Neural machine translation between the writings of Shakespeare and modern English using TensorFlow

last year

247neural-machine-translationseq2seqshakespeare