file-select

A library to invoke the native system file dialog to select or create files.

Common Lisp15zlib

7 months ago

OneupUploaderBundle

This Symfony bundle provides a server implementation for handling single and mul

PHP597mit

6 months ago

chunked-uploadsdropzonefineuploader

copyparty

copyparty

Portable file server with accelerated resumable uploads, dedup, WebDAV, FTP, TFT

Python450mit

16 days ago

copypartyfile-serverfile-sharing

osx-abi-macho-file-format-reference

Mirror of OS X ABI Mach-O File Format Reference

738

5 months ago

abiapplemach-o

sigma-file-manager

sigma-file-manager

"Sigma File Manager" is a free, open-source, quickly evolving, modern file manag

C3259other

2 months ago

appelectronelectron-app

laravel-file-manager

laravel-file-manager

File manager for Laravel

PHP1048mit

6 months ago

file-viewer

Web component file viewer

HTML32

last year

htmljavascriptsvelte

jQuery-File-Upload

File Upload widget with multiple file selection, drag&drop support, progress bar

PHP30994mit

12 months ago

react-native-file-upload

A plugin for file upload on react-native

Objective-C114mit

8 years ago

action-autotag

action-autotag

Automatically generate a new tag when the manifest file (package.json, Dockerfil

JavaScript68mit

2 months ago

actionactionsautomation

vue-file-upload

vue-file-upload

A file management system built with Vue.js and TypeScript that allows for single

Vue25mit

7 months ago

drag-and-drop-filesfile-dropzonefile-manager

file-opener

Capacitor File Opener. The plugin is able to open a file given the mimeType and

Swift54mit

6 months ago

capacitor-file-picker

⚡️ Capacitor plugin that allows the user to select a file.

Swift63mit

last year

androidcapacitorcapacitor-android

Filefile

A file to keep track of all the files you have in your repo that end in "file".

75

2 years ago

SublimeText-File-Navigator

SublimeText-File-Navigator

File Navigator plugin for Sublime Text

Python56

11 years ago

lumen-file-manager

File manager module for the Lumen PHP framework.

PHP38mit

6 years ago

filefileslumen

fswatch

A cross-platform file change monitor with multiple backends: Apple OS X File Sys

C++4902gpl-3.0

3 months ago

cc-plus-pluschange-monitor

flow.js

A JavaScript library providing multiple simultaneous, stable, fault-tolerant and

JavaScript2936other

9 months ago

File-Manager

File-Manager

Easy app for managing your files without ads, respecting your privacy & security

Kotlin413gpl-3.0

2 days ago

androidfile-managerfoss

gulp-file-include

MAINTAINER WANTED ~ [gulp-file-include] a gulp plugin for file include

JavaScript676mit

2 years ago

capacitor-file-selector

Java14

3 years ago

telescope-git-file-history.nvim

Open/preview contents of the current file at a specific commit, without using gi

Lua48mit

2 months ago

neovim-plugin

flask-file-upload

flask-file-upload

Easy file uploads for Flask.

Python151mit

last year

flaskflask-sqlalchemysqlalchemy

hashmark

Take contents of a file (or stdin), and output as new file with a hash in the na

JavaScript195mit

4 years ago

vast

vast

A simple tool for vlang, generate v source file to AST json file

V25mit

3 years ago

astvvlang

little-file-explorer

little-file-explorer

Android 1.0+ mini file explorer and manager

Java292gpl-3.0

2 months ago

androidcompatibilityf-droid

intent-utterance-file-parser

Parse an intent utterance file, like the Alexa Skills Kit Sample Utterance file.

JavaScript7mit

9 years ago

vue-file-toolbar-menu

vue-file-toolbar-menu

:desktop_computer: UI file/toolbar menus for Vue apps

Vue139mit

9 months ago

applicationbardocument

Android-File-Manager

An open source file manager for the android platform

Java182

5 years ago

file-size

file-size

📂 Lightweight filesize to human-readable / proportions w/o dependencies for nod

JavaScript231mit

4 years ago

sshfs

File system based on the SSH File Transfer Protocol

C1125gpl-2.0

2 years ago

create-issue-from-file

A GitHub action to create an issue using content from a file

TypeScript132mit

12 days ago

github-actiongithub-issues

reaction-file-collections

Reaction File Collection packages

JavaScript19mit

2 years ago

react-native-create-new-file-ios

A react native interface for creating a unique new file. File must not exist alr

Objective-C2

8 years ago

vue-file-agent

vue-file-agent

The most beautiful and full featured file upload component for Vue JS

TypeScript724mit

7 months ago

Secure-File-Manager

Secure-File-Manager

Secure File Manager is open source file manager for keeping your files in safe.

Kotlin159gpl-3.0

2 years ago

androidencryptionfilemanager

file-attributes

Access to common file attributes (uid, gid, permissions, ctime, mtime, atime)

Common Lisp11zlib

6 months ago

file-notify

OS portability library for file change detection.

Common Lisp22zlib

11 months ago

Simple-File-Manager

Simple-File-Manager

Easy app for managing your files without ads, respecting your privacy & security

Kotlin1461gpl-3.0

3 days ago

androidandroid-developmentfile-manager

file-type

Detect the file type of a Buffer/Uint8Array/ArrayBuffer

JavaScript3483mit

19 days ago

bufferdetectfile

file-type-cli

Detect the file type of a file or stdin

JavaScript70mit

2 years ago

load-json-file

Read and parse a JSON file

JavaScript240mit

last year

move-file

Move a file - Even works across devices

JavaScript195mit

7 months ago

write-json-file

Stringify and write JSON to a file atomically

JavaScript209mit

2 years ago

custom_uploader

Custom Uploader is a simple, lightweight, and easy to use file uploader built us

Dart37mit

last month

androidflutterhosting

BlazorFileReader

Library for creating read-only file streams from file input elements or drop tar

C#422mit

10 months ago

blazorc-sharpstream

vlog.nvim

Single file, no dependency, easy copy & paste log file to add to your neovim lua

Lua118mit

7 months ago

gulp-cssimport

Parses a CSS file, finds imports, grabs the content of the linked file and repla

JavaScript35mit

5 years ago

gulp-plugin

JUnitReportKpiJMeterDashboardStats

JUnitReportKpiJMeterDashboardStats

This tool read KPI declarations in a file and apply the KPI assertion on a JMete

Java2

10 months ago

cicdjmeterjmeter-plugin

JUnitReportKpiJMeterReportCsv

JUnitReportKpiJMeterReportCsv

This tool read KPI declarations in a file and apply the KPI assertion on a JMete

Java0

10 months ago

cicdjmeterjmeter-plugin

react-native-file-viewer

react-native-file-viewer

Native file viewer for React Native. Preview any type of file supported by the m

Java419mit

4 months ago

Mqtt-File-Uploader

C#4mit

last year

md2png

md2png

Render markdown file to PNG image. Support custom CSS URL/file.

Go31

6 years ago

cssefficiencyhtml

android-file-manager

File Manager

File Manager with two panels, smart copy/move dialogs, easy open/share files, mu

Java23gpl-3.0

2 years ago

lens-file-source

Gaia File storage abstraction through mechanisms like caching, transactions and

TypeScript1mit

5 years ago

plupload

Plupload is JavaScript API for building file uploaders. It supports multiple fil

JavaScript5618agpl-3.0

5 months ago

file-uploadfile-utilityplupload

files-playgroundbook

File Browser Swift Playground Book

Swift205

8 years ago

cakephp-file-storage

Abstract file storage and upload plugin for CakePHP. Write to local disk, FTP, S

PHP203mit

3 years ago

cakephpdropboxftp

cakephp-file-storage

Abstract file storage and upload plugin for CakePHP. Write to local disk, FTP, S

PHP4mit

5 months ago

vapor-simple-file-logger

📝 A Swift Vapor provider for simple file logging on Vapor sites

Swift18mit

4 years ago

fileloggerlogging

readmine

readmine

Example README file demonstrating a suggested README file structure for software

53other

3 months ago

best-practicesdocumentationguidelines

react-native-file-download

[DEPRECATED] Native file download utility for react-native

Objective-C47mit

8 years ago

FluentFTP

FluentFTP

An FTP and FTPS client for .NET & .NET Standard, optimized for speed. Provides e

C#2870mit

3 months ago

ftpftp-clientftps

abcrypt

A simple, modern and secure file encryption tool, file format and Rust library

Rust6

2 months ago

abcryptabcrypt-encryptionargon2

HRConvert2

HRConvert2

A self-hosted, drag-and-drop & nosql file conversion server & share tool that su

PHP898gpl-3.0

20 days ago

archiverconversionconverter

ng2-file-upload

Easy to use Angular components for files upload

TypeScript1905mit

10 months ago

vfsStream

vfsStream is a stream wrapper for a virtual file system that may be helpful in u

PHP1399bsd-3-clause

4 months ago

filesystemphptesting

es-file-traverse

es-file-traverse

Traverse ECMAScript (JavaScript) files by their `import`/`require` chains

JavaScript2mit

last year

amdecmascriptimport

rxjava-file

RxJava observables for files including NIO events

Java82apache-2.0

5 years ago

MarkdownShellExtensions

MarkdownShellExtensions

A Markdown Text Editor to manually edit a markdown file, with instant preview of

Pascal35apache-2.0

6 months ago

slog

slog

📑 Lightweight, configurable, extensible logging library written in Go. Support

Go334mit

3 months ago

console-loggerfile-loggingformatter

Nauz-File-Detector

Nauz-File-Detector

Linker/Compiler/Tool detector for Windows, Linux and MacOS.

C++488mit

yesterday

detecthacktoberfesthacktoberfest2023

filetree

filetree

filetree is an emacs package for displaying and operating on a file list as a fi

Emacs Lisp88gpl-3.0

2 years ago

ipfs-add-from-url

A command line executable to add a file to IPFS from a URL instead of a file pat

JavaScript25

7 years ago

cliipfs

onebusaway-gtfs-to-barefoot

A Java application that takes a GTFS file and produces a Barefoot map file

Java1other

4 years ago

find-file-in-project

find-file-in-project

Quick access to project files in Emacs

Emacs Lisp426gpl-3.0

last year

enhanced-github

enhanced-github

:rocket: Browser extension to display size of each file, download link and copy

JavaScript2000mit

7 months ago

chrome-browserchrome-extensionclipboard

file-changes-action

This action can be added, and you will get outputs of all of the files that have

TypeScript162mit

last year

awesome-go-extra

Parse awesome-go README file and generate a new README file with repo info.

Go22mit

2 years ago

Integrity Check GTK

Integrity Check - Vinari Software is a Linux application written in Vala and GTK

Vala1bsd-3-clause

2 years ago

checksumgnomegtk

Chaosreader

An any-snarf program that processes application protocols (HTTP/FTP/...) from tc

217

3 years ago

FlyingCarpet

FlyingCarpet

Description Direct file transfer between iOS, Android, Linux, and Windows wit

Rust2820gpl-3.0

3 months ago

androidcross-platformfile-transfer

s3fs-c

S3FS-C is a FUSE (File System in User Space) based file system backed by Amazon

C++134gpl-2.0

11 years ago

orgro

orgro

Description Orgro is an Org Mode file viewer with lots of features for comfor

Dart442gpl-3.0

2 months ago

androidemacsflutter

homebank-converter

A web app to convert an export bank file to compatible Homebank csv file.

CSS54mit

10 months ago

homebank

vue-dotmd-loader

A webpack loader for markdown file transform to vue file.

JavaScript10mit

last year

vue-dotmd-loadervue-markdown-laoderwebpack-loader

tinyfilemanager

tinyfilemanager

Single-file PHP file manager, browser and manage your files efficiently and easi

PHP4484gpl-3.0

18 days ago

code-editorfile-browserfile-explorer

noia

noia

[WIP] Simple mobile applications sandbox file browser tool. Powered with [frida.

JavaScript110mit

3 years ago

androidandroid-securityandroid-tools

webc

Single File Web Components

JavaScript1228mit

11 months ago

gasmask

Hosts file manager for OS X

Objective-C3633

last year

filelogger

A lightweight yet feature-rich file logger implementation for the Microsoft.Exte

C#131mit

9 months ago

shortpaste

shortpaste

A Go based URL shortener, pastebin and file uploader

Vue45mit

5 months ago

remix

Automatic recompilation of mix code on file change.

Elixir148other

6 years ago

mmarkdown

mmarkdown

Interpret mmd fenced code blocks in a markdown file and generate a cooler versio

JavaScript76

3 years ago

generatorjavascriptmarkdown

SublimeOnSaveBuild

Trigger a build the moment you save a file in Sublime Text 2. Works best with we

JavaScript232

6 years ago

deadbolt

deadbolt

Dead-simple file encryption for any OS

JavaScript317mit

last year

aes-256cryptographyencryption

flutter-image-sequence-animator

A simple widget for animating a set of images with full custom controls as an al

Dart145mit

2 years ago

Void

Void

Fast and elegant file hosting service.

TypeScript206mit

last year

discord-botdiscord-embeddocker

csvprintf

Simple CSV file parser for the UNIX command line

C38apache-2.0

4 months ago

sizeable

An Elixir library to make File Sizes human-readable

Elixir38mit

9 months ago

download

Downloads remote file and stores it in the filesystem

Elixir33

2 years ago

nfiles

User configuration and data file management

Common Lisp12bsd-3-clause

6 months ago

pelib

PE file manipulation library.

C++61mit

4 years ago

lambda-refarch-fileprocessing

lambda-refarch-fileprocessing

Serverless Reference Architecture for Real-time File Processing

Python451apache-2.0

last year

bfs

bfs

The Baidu File System.

C++2847bsd-3-clause

5 years ago

externalconfig

Play! module to allow you to load an external properties file. Useful when depl

Java8mpl-2.0

12 years ago

inih

Simple .INI file parser in C, good for embedded systems

C2279other

4 months ago

cconfigparserembedded-systems

umidiparser

MIDI file parser for Micropython, CircuitPython and Python

Python24mit

12 months ago

tuql

Automatically create a GraphQL server from a SQLite database or a SQL file

JavaScript1042mit

3 years ago

automatic-apiforeign-keysgraphql

Upload

File uploads with validation and storage strategies

PHP1674mit

6 months ago

OpenExplorer

An open source advanced file manager for all Android devices - Phones, Tablets,

Java79

9 years ago

argsd

A command line and config file parser for DLang

D15lgpl-3.0

3 years ago

command-line-parserconfigparserconfiguration-file

inifiled

a compile time ini file parser and writter generator for D

D23lgpl-3.0

2 years ago

vfs

Pluggable, extensible virtual file system for Go

Go268mit

3 months ago

whobrokemycode

A ZSH plugin to highlight where a particular line was last changed in a file usi

Shell0mit

5 years ago

Remotery

Remotery

Single C file, Realtime CPU/GPU Profiler with Remote Web Viewer

C2620apache-2.0

10 months ago

ccpucuda

fileDroppa

Angular2 File Dropzone

TypeScript0

8 years ago

attache

Yet another approach to file upload

Ruby203mit

4 years ago

nvim-genghis

Convenience file operations for neovim, written in lua.

Lua184mit

3 months ago

neovim-pluginnvim

terraform-cloudinit-container-server

A batteries included cloud-init config to quickly and easily deploy a single Doc

HCL95mit

2 years ago

awsazurecloudinit

csvlint

library and command line tool that validates a CSV file

Makefile185apache-2.0

6 months ago

redoctober

Go server for two-man rule style file encryption and decryption.

Go1390other

3 days ago

NoDb

a "no database" file system storage for .NET Core/ASP.NET Core because not every

C#180apache-2.0

last year

fastfinder

fastfinder

Incident Response - Fast suspicious file finder

Go218mit

2 years ago

dfirincident-responseinvestigation

pics

pics

File formats dissections and more...

Assembly10333

3 months ago

dissectionfileformatspatreon

goimghdr

goimghdr

The imghdr module determines the type of image contained in a file for go

Go40bsd-3-clause

5 years ago

goimghdr

firmwalker

firmwalker

Script for searching the extracted firmware file system for goodies!

Shell989gpl-3.0

9 months ago

sha1collisiondetection

Library and command line tool to detect SHA-1 collision in a file

C1273other

11 months ago

bookmarks.nvim

bookmarks.nvim

Remember file locations and sort by time and frequency and support telescope.

Lua188mit

3 months ago

bookmarksluaneovim

gpg-crypt

A simple file/directory encryption/decryption plugin for ZSH.

Shell9mit

6 years ago

pyramid_storage

File upload management for the Pyramid web framework

Python13other

last year

ddh

A fast duplicate file finder

Rust433other

2 years ago

clirust

LocalizedView

LocalizedView

Setting up application specific localized string within xib file.

Objective-C8mit

8 years ago

codem-isoboxer

A lightweight browser-based MPEG-4 (ISOBMFF) file/box parser.

JavaScript111other

30 days ago

QtXlsxWriter

QtXlsxWriter

.xlsx file reader and writer for Qt5

C++1147other

3 years ago

Pathos

Pathos

File management and path analysis for Swift

Swift111mit

2 years ago

filesystemswiftvfs

stegify

stegify

🔍 Go tool for LSB steganography, capable of hiding any file within an image.

Go1162mit

last year

clidecodingencoding

swift_playgrounds

A collection of Swift playgrounds demonstrating language basics, JSON parsing, H

Swift15

9 years ago

p10k-promptconfig

oh-my-zsh plugin for powerlevel10k prompt config files, lets you change your pow

Shell2mit

2 years ago

artifact

File upload and on-the-fly processing for Elixir

Elixir44apache-2.0

6 years ago

dlog

A minimal logger with icons and file logging support

TypeScript4gpl-3.0

2 years ago

denodeno-modulejavascript

Dragonfly2

Dragonfly2

Dragonfly is an open source P2P-based file distribution and image acceleration s

Go1926apache-2.0

2 months ago

cloud-nativecncfcontainers

fat

Not very useful utility for file enlargement.

C++5

9 years ago

ScreenToLayers

macOS app to capture your screen as a layered PSD file

Objective-C141mit

7 years ago

HTTPForm

Actionscript 3 library to emulate a multipart/form-data HTML form submission req

ActionScript5mit

12 years ago

apkleaks

apkleaks

Scanning APK file for URIs, endpoints & secrets.

Python4646apache-2.0

4 days ago

android-securityapkapk-parser

fff

fff

📁 A simple file manager written in bash.

Shell4034mit

3 months ago

bashfile-managerterminal

tlse

Single C file TLS 1.2/1.3 implementation, using tomcrypt as crypto library

C521other

3 months ago

tls

filetree.nvim

filetree.nvim

File manager

Lua12

2 years ago

dirbuf.nvim

A file manager for Neovim which lets you edit your filesystem like you edit text

Lua426agpl-3.0

2 years ago

file-managerluaneovim

love-ase

Aseprite file loader for love2d

Lua34mit

10 months ago

asepritelove2dlua

DotNetJS

DotNetJS

Consume C# in JavaScript with comfort: single-file UMD library, auto-generated 2

JavaScript608mit

5 months ago

bindingscodegencsharp

fsf

File Scanning Framework

Python282apache-2.0

3 years ago

file-analysisfile-analyzernetwork-defense

macOS-Fortress

macOS-Fortress

Firewall and Privatizing Proxy for Trackers, Attackers, Malware, Adware, and Spa

Shell404mit

2 years ago

adblockadblockinganti-virus

iqe

Load an Inter-Quake Export file into Lua

Lua8other

9 years ago

linguist-action

Detects language type for a file, or, given a repository, determine language bre

6mit

12 months ago

github-actiongithub-actionslanguage-detection

scrubcsv

Remove bad records from a CSV file and normalize

Rust56

2 years ago

Uploady

Uploady

Simple File Uploading Software

PHP71mit

last month

file-sharingfile-uploadfile-uploads

LinCal

An Android app to show notifications with custom links or messages, scheduled by

Java7other

5 years ago

criticalCSS

Finds the Above the Fold CSS for your page, and outputs it into a file

JavaScript1697mit

2 years ago

filestack-rails

filestack-rails

Official Ruby on Rails plugin for Filestack File Picker that makes it easy to ad

JavaScript223apache-2.0

5 months ago

hacktoberfestrubyruby-gem

fine-uploader

fine-uploader

Multiple file upload plugin with image previews, drag and drop, progress bars. S

JavaScript8191mit

6 years ago

apidropzonefile-upload

enzypt

A p2p, end to end encrypted file selling platform utilising Ethereum and IPFS.

JavaScript34gpl-3.0

last year

MediaHut

MediaHut

A truly single-file, no-database, drop-in PHP media gallery.

PHP22mit

2 years ago

galleryimage-gallerymedia-gallery

fm-flatfile

Scala Library for Reading Flat File Data (CSV/TSV/XLS/XLSX)

Scala10apache-2.0

10 months ago

FDWaveformView

FDWaveformView

Reads an audio file and displays the waveform

Swift1213mit

2 months ago

audiococoapodios

PlayerNodePlayground

PlayerNodePlayground

Swift playground using AVAudioEngine with a playernode and effects to play an au

Swift3mit

4 years ago

audioavaudioengineswift

abf_io

A library of access routines to Axon's ABF file format (electrophysiology, most

Ada0gpl-3.0

6 years ago

grav

Modern, Crazy Fast, Ridiculously Easy and Amazingly Powerful Flat-File CMS power

PHP14125mit

6 months ago

cmscontentcontent-management

lf

lf

Terminal file manager

Go7285mit

12 days ago

file-managerterminal

jimfs

An in-memory file system for Java 7+

Java2311apache-2.0

8 months ago

samba-documents-provider

Access network file shares directly from the Android Downloads/Files app

Java638gpl-3.0

4 years ago

android-applicationlibsmbclient

obelisk

obelisk

Go package and CLI tool for saving web page as single HTML file

Go226mit

3 months ago

archivecligo

esofiles

The Esoteric File Archive

C93

4 months ago

esolangesoteric-programming-language

Invoke-CreateModuleHelpFile

Invoke-CreateModuleHelpFile

PowerShell function to create a HTML help file for a module and all it's command

PowerShell38

10 years ago

rnaseq_tutorial

Informatics for RNA-seq: A web resource for analysis on the cloud. Educational t

R1299other

12 months ago

eosfilestore

eosfilestore

📜🔗 Immutable, censorship resistant, cheap, file storage on EOS blockchain

WebAssembly45mit

last year

blockchaineosfile-upload

SwarmManagement

Swarm Management is a python application, installed with pip. The application ma

Python10mit

3 years ago

containersdeploymentdocker

headr

Adds header / banner info to a file. Nice to use as npm script :)

JavaScript3

8 years ago

fixpack

A package.json file scrubber for the truly insane.

JavaScript458

2 years ago

AnalyzePE

Wraps around various tools and provides some additional checks/information to pr

Python201

10 years ago

flop

flop

Go file operations library chasing GNU APIs.

Go34mit

2 years ago

hf

(another) Fuzzy file finder for the command line

Go330mit

23 days ago

dev-kt

dev-kt

:crystal_ball: Single file Kotlin/Java IDE features in lightweight.

Kotlin89gpl-3.0

3 years ago

devkteditoride

ParameterHandler

Composer script handling your ignored parameter file

PHP925mit

6 months ago

composercomposer-scriptsenvironment-variables

Ares

Ares

Zero-setup P2P file transfer between Macs and iOS devices

Swift132mit

8 years ago

ResignTool

ResignTool

An app for macOS that can (re)sign apps and bundle them into ipa files that are

Objective-C394mit

4 years ago

ironssh

Secure end-to-end encrypted file sharing over ssh; forked from openssh.

C62other

2 years ago

fm-nvim

fm-nvim

🗂 Neovim plugin that lets you use your favorite terminal file managers (and fuz

Lua264gpl-3.0

5 months ago

ffffile-managerfm

PersistentStorageSerializable

Swift library that makes easier to serialize the user's preferences (app's setti

Swift161mit

7 years ago

cocoapodnsuserdefaultsplist

mask

mask

🎭 A CLI task runner defined by a simple markdown file

Rust971mit

5 months ago

maketask-runner

nnn

nnn

n³ The unorthodox terminal file manager

C18291bsd-2-clause

11 days ago

androidbatch-renamec

Leanify

lightweight lossless file minifier/optimizer

C801mit

7 months ago

compressiondata-uriepub

mlog

A simple logging module for go, with a rotating file feature and console logging

Go33mit

6 years ago

mpy-miniterm

Tool for seamless serial debug and file synchronisation with MicroPython devices

Python21other

4 months ago

horcrux

horcrux

Split your file into encrypted fragments so that you don't need to remember a pa

Go4407mit

8 months ago

denoliver

denoliver

A simple, dependency free static file server for Deno with possibly the worst na

TypeScript98mit

2 years ago

clidenodenoland

InjectionIII

InjectionIII

Description Quite simply, InjectionIII adds "Hot Reloading" capability to you

Objective-C3793mit

4 months ago

evalhot-reloadinjection

seeing_is_believing

seeing_is_believing

Displays the results of every line of code in your file

Ruby1297

2 years ago

cassius

Not maintained. -- NIF-based linux file system events

C9

8 years ago

file-select

A library to invoke the native system file dialog to select or create files.

Common Lisp15zlib

7 months ago

OneupUploaderBundle

This Symfony bundle provides a server implementation for handling single and mul

PHP597mit

6 months ago

chunked-uploadsdropzonefineuploader

copyparty

copyparty

Portable file server with accelerated resumable uploads, dedup, WebDAV, FTP, TFT

Python450mit

16 days ago

copypartyfile-serverfile-sharing

osx-abi-macho-file-format-reference

Mirror of OS X ABI Mach-O File Format Reference

738

5 months ago

abiapplemach-o

sigma-file-manager

sigma-file-manager

"Sigma File Manager" is a free, open-source, quickly evolving, modern file manag

C3259other

2 months ago

appelectronelectron-app

laravel-file-manager

laravel-file-manager

File manager for Laravel

PHP1048mit

6 months ago

file-viewer

Web component file viewer

HTML32

last year

htmljavascriptsvelte

jQuery-File-Upload

File Upload widget with multiple file selection, drag&drop support, progress bar

PHP30994mit

12 months ago

react-native-file-upload

A plugin for file upload on react-native

Objective-C114mit

8 years ago

action-autotag

action-autotag

Automatically generate a new tag when the manifest file (package.json, Dockerfil

JavaScript68mit

2 months ago

actionactionsautomation

vue-file-upload

vue-file-upload

A file management system built with Vue.js and TypeScript that allows for single

Vue25mit

7 months ago

drag-and-drop-filesfile-dropzonefile-manager

file-opener

Capacitor File Opener. The plugin is able to open a file given the mimeType and

Swift54mit

6 months ago

capacitor-file-picker

⚡️ Capacitor plugin that allows the user to select a file.

Swift63mit

last year

androidcapacitorcapacitor-android

Filefile

A file to keep track of all the files you have in your repo that end in "file".

75

2 years ago

SublimeText-File-Navigator

SublimeText-File-Navigator

File Navigator plugin for Sublime Text

Python56

11 years ago

lumen-file-manager

File manager module for the Lumen PHP framework.

PHP38mit

6 years ago

filefileslumen

fswatch

A cross-platform file change monitor with multiple backends: Apple OS X File Sys

C++4902gpl-3.0

3 months ago

cc-plus-pluschange-monitor

flow.js

A JavaScript library providing multiple simultaneous, stable, fault-tolerant and

JavaScript2936other

9 months ago

File-Manager

File-Manager

Easy app for managing your files without ads, respecting your privacy & security

Kotlin413gpl-3.0

2 days ago

androidfile-managerfoss

gulp-file-include

MAINTAINER WANTED ~ [gulp-file-include] a gulp plugin for file include

JavaScript676mit

2 years ago

capacitor-file-selector

Java14

3 years ago

telescope-git-file-history.nvim

Open/preview contents of the current file at a specific commit, without using gi

Lua48mit

2 months ago

neovim-plugin

flask-file-upload

flask-file-upload

Easy file uploads for Flask.

Python151mit

last year

flaskflask-sqlalchemysqlalchemy

hashmark

Take contents of a file (or stdin), and output as new file with a hash in the na

JavaScript195mit

4 years ago

vast

vast

A simple tool for vlang, generate v source file to AST json file

V25mit

3 years ago

astvvlang

little-file-explorer

little-file-explorer

Android 1.0+ mini file explorer and manager

Java292gpl-3.0

2 months ago

androidcompatibilityf-droid

intent-utterance-file-parser

Parse an intent utterance file, like the Alexa Skills Kit Sample Utterance file.

JavaScript7mit

9 years ago

vue-file-toolbar-menu

vue-file-toolbar-menu

:desktop_computer: UI file/toolbar menus for Vue apps

Vue139mit

9 months ago

applicationbardocument

Android-File-Manager

An open source file manager for the android platform

Java182

5 years ago

file-size

file-size

📂 Lightweight filesize to human-readable / proportions w/o dependencies for nod

JavaScript231mit

4 years ago

sshfs

File system based on the SSH File Transfer Protocol

C1125gpl-2.0

2 years ago

create-issue-from-file

A GitHub action to create an issue using content from a file

TypeScript132mit

12 days ago

github-actiongithub-issues

reaction-file-collections

Reaction File Collection packages

JavaScript19mit

2 years ago

react-native-create-new-file-ios

A react native interface for creating a unique new file. File must not exist alr

Objective-C2

8 years ago

vue-file-agent

vue-file-agent

The most beautiful and full featured file upload component for Vue JS

TypeScript724mit

7 months ago

Secure-File-Manager

Secure-File-Manager

Secure File Manager is open source file manager for keeping your files in safe.

Kotlin159gpl-3.0

2 years ago

androidencryptionfilemanager

file-attributes

Access to common file attributes (uid, gid, permissions, ctime, mtime, atime)

Common Lisp11zlib

6 months ago

file-notify

OS portability library for file change detection.

Common Lisp22zlib

11 months ago

Simple-File-Manager

Simple-File-Manager

Easy app for managing your files without ads, respecting your privacy & security

Kotlin1461gpl-3.0

3 days ago

androidandroid-developmentfile-manager

file-type

Detect the file type of a Buffer/Uint8Array/ArrayBuffer

JavaScript3483mit

19 days ago

bufferdetectfile

file-type-cli

Detect the file type of a file or stdin

JavaScript70mit

2 years ago

load-json-file

Read and parse a JSON file

JavaScript240mit

last year

move-file

Move a file - Even works across devices

JavaScript195mit

7 months ago

write-json-file

Stringify and write JSON to a file atomically

JavaScript209mit

2 years ago

custom_uploader

Custom Uploader is a simple, lightweight, and easy to use file uploader built us

Dart37mit

last month

androidflutterhosting

pingvin-share

pingvin-share

A self-hosted file sharing platform that combines lightness and beauty, perfect

TypeScript1995bsd-2-clause

17 days ago

file-sharingnestjsnextjs

BlazorFileReader

Library for creating read-only file streams from file input elements or drop tar

C#422mit

10 months ago

blazorc-sharpstream

vlog.nvim

Single file, no dependency, easy copy & paste log file to add to your neovim lua

Lua118mit

7 months ago

gulp-cssimport

Parses a CSS file, finds imports, grabs the content of the linked file and repla

JavaScript35mit

5 years ago

gulp-plugin

JUnitReportKpiJMeterDashboardStats

JUnitReportKpiJMeterDashboardStats

This tool read KPI declarations in a file and apply the KPI assertion on a JMete

Java2

10 months ago

cicdjmeterjmeter-plugin

JUnitReportKpiJMeterReportCsv

JUnitReportKpiJMeterReportCsv

This tool read KPI declarations in a file and apply the KPI assertion on a JMete

Java0

10 months ago

cicdjmeterjmeter-plugin

react-native-file-viewer

react-native-file-viewer

Native file viewer for React Native. Preview any type of file supported by the m

Java419mit

4 months ago

Mqtt-File-Uploader

C#4mit

last year

md2png

md2png

Render markdown file to PNG image. Support custom CSS URL/file.

Go31

6 years ago

cssefficiencyhtml

android-file-manager

File Manager

File Manager with two panels, smart copy/move dialogs, easy open/share files, mu

Java23gpl-3.0

2 years ago

lens-file-source

Gaia File storage abstraction through mechanisms like caching, transactions and

TypeScript1mit

5 years ago

rustypaste

rustypaste

A minimal file upload/pastebin service.

Rust628mit

3 months ago

file-sharingfile-uploadfile-upload-server

plupload

Plupload is JavaScript API for building file uploaders. It supports multiple fil

JavaScript5618agpl-3.0

5 months ago

file-uploadfile-utilityplupload

files-playgroundbook

File Browser Swift Playground Book

Swift205

8 years ago

cakephp-file-storage

Abstract file storage and upload plugin for CakePHP. Write to local disk, FTP, S

PHP203mit

3 years ago

cakephpdropboxftp

cakephp-file-storage

Abstract file storage and upload plugin for CakePHP. Write to local disk, FTP, S

PHP4mit

5 months ago

seafile

seafile

High performance file syncing and sharing, with also Markdown WYSIWYG editing, W

C11673other

23 days ago

cloud-storagedocument-managementfile-sharing

vapor-simple-file-logger

📝 A Swift Vapor provider for simple file logging on Vapor sites

Swift18mit

4 years ago

fileloggerlogging

readmine

readmine

Example README file demonstrating a suggested README file structure for software

53other

3 months ago

best-practicesdocumentationguidelines

react-native-file-download

[DEPRECATED] Native file download utility for react-native

Objective-C47mit

8 years ago

FluentFTP

FluentFTP

An FTP and FTPS client for .NET & .NET Standard, optimized for speed. Provides e

C#2870mit

3 months ago

ftpftp-clientftps

abcrypt

A simple, modern and secure file encryption tool, file format and Rust library

Rust6

2 months ago

abcryptabcrypt-encryptionargon2

HRConvert2

HRConvert2

A self-hosted, drag-and-drop & nosql file conversion server & share tool that su

PHP898gpl-3.0

20 days ago

archiverconversionconverter

ng2-file-upload

Easy to use Angular components for files upload

TypeScript1905mit

10 months ago

vfsStream

vfsStream is a stream wrapper for a virtual file system that may be helpful in u

PHP1399bsd-3-clause

4 months ago

filesystemphptesting

es-file-traverse

es-file-traverse

Traverse ECMAScript (JavaScript) files by their `import`/`require` chains

JavaScript2mit

last year

amdecmascriptimport

rxjava-file

RxJava observables for files including NIO events

Java82apache-2.0

5 years ago

MarkdownShellExtensions

MarkdownShellExtensions

A Markdown Text Editor to manually edit a markdown file, with instant preview of

Pascal35apache-2.0

6 months ago

slog

slog

📑 Lightweight, configurable, extensible logging library written in Go. Support

Go334mit

3 months ago

console-loggerfile-loggingformatter

Nauz-File-Detector

Nauz-File-Detector

Linker/Compiler/Tool detector for Windows, Linux and MacOS.

C++488mit

yesterday

detecthacktoberfesthacktoberfest2023

filetree

filetree

filetree is an emacs package for displaying and operating on a file list as a fi

Emacs Lisp88gpl-3.0

2 years ago

ipfs-add-from-url

A command line executable to add a file to IPFS from a URL instead of a file pat

JavaScript25

7 years ago

cliipfs

onebusaway-gtfs-to-barefoot

A Java application that takes a GTFS file and produces a Barefoot map file

Java1other

4 years ago

find-file-in-project

find-file-in-project

Quick access to project files in Emacs

Emacs Lisp426gpl-3.0

last year

enhanced-github

enhanced-github

:rocket: Browser extension to display size of each file, download link and copy

JavaScript2000mit

7 months ago

chrome-browserchrome-extensionclipboard

file-changes-action

This action can be added, and you will get outputs of all of the files that have

TypeScript162mit

last year

awesome-go-extra

Parse awesome-go README file and generate a new README file with repo info.

Go22mit

2 years ago

Integrity Check GTK

Integrity Check - Vinari Software is a Linux application written in Vala and GTK

Vala1bsd-3-clause

2 years ago

checksumgnomegtk

Chaosreader

An any-snarf program that processes application protocols (HTTP/FTP/...) from tc

217

3 years ago

FlyingCarpet

FlyingCarpet

Description Direct file transfer between iOS, Android, Linux, and Windows wit

Rust2820gpl-3.0

3 months ago

androidcross-platformfile-transfer

s3fs-c

S3FS-C is a FUSE (File System in User Space) based file system backed by Amazon

C++134gpl-2.0

11 years ago

orgro

orgro

Description Orgro is an Org Mode file viewer with lots of features for comfor

Dart442gpl-3.0

2 months ago

androidemacsflutter

homebank-converter

A web app to convert an export bank file to compatible Homebank csv file.

CSS54mit

10 months ago

homebank

vue-dotmd-loader

A webpack loader for markdown file transform to vue file.

JavaScript10mit

last year

vue-dotmd-loadervue-markdown-laoderwebpack-loader

tinyfilemanager

tinyfilemanager

Single-file PHP file manager, browser and manage your files efficiently and easi

PHP4484gpl-3.0

18 days ago

code-editorfile-browserfile-explorer

noia

noia

[WIP] Simple mobile applications sandbox file browser tool. Powered with [frida.

JavaScript110mit

3 years ago

androidandroid-securityandroid-tools

webc

Single File Web Components

JavaScript1228mit

11 months ago

gasmask

Hosts file manager for OS X

Objective-C3633

last year

filelogger

A lightweight yet feature-rich file logger implementation for the Microsoft.Exte

C#131mit

9 months ago

shortpaste

shortpaste

A Go based URL shortener, pastebin and file uploader

Vue45mit

5 months ago

remix

Automatic recompilation of mix code on file change.

Elixir148other

6 years ago

mmarkdown

mmarkdown

Interpret mmd fenced code blocks in a markdown file and generate a cooler versio

JavaScript76

3 years ago

generatorjavascriptmarkdown

SublimeOnSaveBuild

Trigger a build the moment you save a file in Sublime Text 2. Works best with we

JavaScript232

6 years ago

deadbolt

deadbolt

Dead-simple file encryption for any OS

JavaScript317mit

last year

aes-256cryptographyencryption

flutter-image-sequence-animator

A simple widget for animating a set of images with full custom controls as an al

Dart145mit

2 years ago

Void

Void

Fast and elegant file hosting service.

TypeScript206mit

last year

discord-botdiscord-embeddocker

csvprintf

Simple CSV file parser for the UNIX command line

C38apache-2.0

4 months ago

sizeable

An Elixir library to make File Sizes human-readable

Elixir38mit

9 months ago

download

Downloads remote file and stores it in the filesystem

Elixir33

2 years ago

nfiles

User configuration and data file management

Common Lisp12bsd-3-clause

6 months ago

pelib

PE file manipulation library.

C++61mit

4 years ago

lambda-refarch-fileprocessing

lambda-refarch-fileprocessing

Serverless Reference Architecture for Real-time File Processing

Python451apache-2.0

last year

bfs

bfs

The Baidu File System.

C++2847bsd-3-clause

5 years ago

externalconfig

Play! module to allow you to load an external properties file. Useful when depl

Java8mpl-2.0

12 years ago

inih

Simple .INI file parser in C, good for embedded systems

C2279other

4 months ago

cconfigparserembedded-systems

umidiparser

MIDI file parser for Micropython, CircuitPython and Python

Python24mit

12 months ago

tuql

Automatically create a GraphQL server from a SQLite database or a SQL file

JavaScript1042mit

3 years ago

automatic-apiforeign-keysgraphql

Upload

File uploads with validation and storage strategies

PHP1674mit

6 months ago

OpenExplorer

An open source advanced file manager for all Android devices - Phones, Tablets,

Java79

9 years ago

argsd

A command line and config file parser for DLang

D15lgpl-3.0

3 years ago

command-line-parserconfigparserconfiguration-file

inifiled

a compile time ini file parser and writter generator for D

D23lgpl-3.0

2 years ago

vfs

Pluggable, extensible virtual file system for Go

Go268mit

3 months ago

whobrokemycode

A ZSH plugin to highlight where a particular line was last changed in a file usi

Shell0mit

5 years ago

Remotery

Remotery

Single C file, Realtime CPU/GPU Profiler with Remote Web Viewer

C2620apache-2.0

10 months ago

ccpucuda

fileDroppa

Angular2 File Dropzone

TypeScript0

8 years ago

attache

Yet another approach to file upload

Ruby203mit

4 years ago

nvim-genghis

Convenience file operations for neovim, written in lua.

Lua184mit

3 months ago

neovim-pluginnvim

terraform-cloudinit-container-server

A batteries included cloud-init config to quickly and easily deploy a single Doc

HCL95mit

2 years ago

awsazurecloudinit

csvlint

library and command line tool that validates a CSV file

Makefile185apache-2.0